DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and tHMG1

DIOPT Version :10

Sequence 1:NP_003192.1 Gene:TFAM / 7019 HGNCID:11741 Length:246 Species:Homo sapiens
Sequence 2:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster


Alignment Length:79 Identity:19/79 - (24%)
Similarity:43/79 - (54%) Gaps:10/79 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    46 LASC---PKKPVSSYLRF----SKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAY 103
            ::.|   ||||:|:::.:    .::.:   ||::||....|:..:..:.||.:.|..|.::|::.
  Fly     1 MSDCGARPKKPMSAFMLWMNSTGRKHI---KAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESA 62

Human   104 RAEWQVYKEEISRF 117
            ......|||::.::
  Fly    63 TTAMAEYKEKLKQW 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_003192.1 HMG-box_TFAM_rpt1 50..115 CDD:438802 18/68 (26%)
HMG-box_TFAM_rpt2 135..234 CDD:438803
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.