DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and CG32202

DIOPT Version :10

Sequence 1:NP_003192.1 Gene:TFAM / 7019 HGNCID:11741 Length:246 Species:Homo sapiens
Sequence 2:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster


Alignment Length:127 Identity:23/127 - (18%)
Similarity:44/127 - (34%) Gaps:48/127 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   130 EKEIMDKHLKRKAMTKKKELTL-----------LGKPKRPRSAYNVYVAERFQEAKGDSPQEKLK 183
            :||:|.|.|..|...:.:.:..           :.|..|.|: ::|.:.:|..:..||       
  Fly     5 KKELMYKQLVEKLYDRCQRIQAENERCVMRVNGIKKIVRRRN-HDVELLKRRLDKHGD------- 61

Human   184 TVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEE 245
                :|:::     .:...|.|                    |:.:..||..|.:.|..|:|
  Fly    62 ----DWRSV-----PMEAPHPK--------------------GKTEQKRRGPKPKNKQAADE 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_003192.1 HMG-box_TFAM_rpt1 50..115 CDD:438802
HMG-box_TFAM_rpt2 135..234 CDD:438803 15/109 (14%)
CG32202NP_730354.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.