Sequence 1: | NP_005800.3 | Gene: | PRDX2 / 7001 | HGNCID: | 9353 | Length: | 198 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523683.1 | Gene: | Prx2540-2 / 36098 | FlyBaseID: | FBgn0033518 | Length: | 220 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 66/204 - (32%) |
---|---|---|---|
Similarity: | 98/204 - (48%) | Gaps: | 27/204 - (13%) |
- Green bases have known domain annotations that are detailed below.
Human 7 RIGKPAPDFKATAVVDGAFKEVKLSDYKG-KYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC 70
Human 71 EVLGVSVDSQFTHLAWIN--------TPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDE----- 122
Human 123 -GIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVC-PAGWKPGSDT-IK 184
Human 185 PNVDDSKEY 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PRDX2 | NP_005800.3 | PRX_Typ2cys | 8..179 | CDD:239313 | 59/186 (32%) |
Prx2540-2 | NP_523683.1 | AhpC | 1..194 | CDD:223527 | 66/201 (33%) |
PRX_1cys | 3..218 | CDD:239314 | 65/203 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165145384 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0450 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100111 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.640 |