DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTN1A1 and dpr11

DIOPT Version :9

Sequence 1:NP_001723.2 Gene:BTN1A1 / 696 HGNCID:1135 Length:526 Species:Homo sapiens
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:308 Identity:69/308 - (22%)
Similarity:107/308 - (34%) Gaps:87/308 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     5 PSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPIL---------AVVGEDAELPCRLSP--NASA 58
            |||......|..:...||:. ||.....|..||.|         ..:|..|.||||:..  |.| 
  Fly    86 PSSATAFSSLAQVSSLLPEA-SALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKS- 148

Human    59 EHLELRWFRKKVSPAVLVHR-----DGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSD 118
                :.|.|.:....:.|.|     |.|....:|..:|               ..|:|:.|:..|
  Fly   149 ----VSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKY---------------WTLQIKYVQARD 194

Human   119 DGEYTCFFREDGSYEEALVHLKVAA-----LGSDPHISMQVQENGEICLEC---------TSVGW 169
            .|.|.|....:... .|.|.|:|..     || :|  ...|:....:.|.|         |.:.|
  Fly   195 AGSYECQVSTEPKV-SARVQLQVVVPRTEILG-EP--DRYVKAGSNVVLRCIVRGALEPPTFIMW 255

Human   170 YPEPQV------QWRTSKGEKFPSTSESRNPDEEGLFTVAASVI----IRDTSAKNVSC------ 218
            |...:.      :.||......|..|      .||..|:.:.:|    .|||.  |.:|      
  Fly   256 YHGAEQLAADSRRHRTQLDPNLPEAS------GEGQSTIGSLIIESAKKRDTG--NYTCSPSNSP 312

Human   219 ---YIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIG 263
               ...|::.|:.....::..|:     |....|::::.::|.::.||
  Fly   313 SATVTLNIINGESSASAVTSSAA-----TTRAYALSILALLLSVILIG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTN1A1NP_001723.2 IG_like 35..141 CDD:214653 29/121 (24%)
Ig_MOG_like 43..142 CDD:143190 26/105 (25%)
Ig 162..223 CDD:299845 18/88 (20%)
SPRY_PRY_BTN1_2 302..473 CDD:293991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..526
dpr11NP_001262320.1 I-set 125..216 CDD:254352 26/111 (23%)
Ig 127..217 CDD:299845 26/110 (24%)
IG_like 227..320 CDD:214653 20/102 (20%)
IGc2 234..311 CDD:197706 18/84 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.