DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTN1A1 and ed

DIOPT Version :9

Sequence 1:NP_001723.2 Gene:BTN1A1 / 696 HGNCID:1135 Length:526 Species:Homo sapiens
Sequence 2:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster


Alignment Length:277 Identity:55/277 - (19%)
Similarity:89/277 - (32%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     2 AVFPSSGLPRCLLTL---ILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLEL 63
            |:..|....|...|:   .|:.|..|.|...    ..|.|......|..|.||.:....|.....
  Fly    11 AIVNSRSARRAATTICNFFLIALVALSSTTL----ADESIDTRENADLTLKCRFNDKYEANDFSF 71

Human    64 RWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVS---DDGEY--- 122
            .|.|...:||..                        |.:|.|.|.|. .|.|:.   :.|.|   
  Fly    72 FWTRWTANPAQF------------------------DNVAIGEVQLS-SGYRLDFQPERGIYDLQ 111

Human   123 ---TCFFREDGSYEEALVHLKVAALGSDPHISMQ-----------VQENGEIC---------LEC 164
               ..:.|::|.:|   ..:|....|:|.|....           |...|.|.         |.|
  Fly   112 IKNVSYNRDNGRFE---CRIKAKGTGADVHQEFHNLTVLTPPHPPVISPGNIAVATEDKPMELTC 173

Human   165 TSVGWYPEPQVQW-RTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLGQE 228
            :|:|..|:|.:.| |.......|:|.......::......:.:..|:.......|.::|..:.:.
  Fly   174 SSIGGSPDPTITWYREGSNTPLPATVLKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEG 238

Human   229 KKVE--ISIPASSLPRL 243
            |::|  .::..:..||:
  Fly   239 KRLEATATLNVNYYPRV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTN1A1NP_001723.2 IG_like 35..141 CDD:214653 23/114 (20%)
Ig_MOG_like 43..142 CDD:143190 22/107 (21%)
Ig 162..223 CDD:299845 12/61 (20%)
SPRY_PRY_BTN1_2 302..473 CDD:293991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..526
edNP_001260013.1 Ig 50..147 CDD:299845 25/124 (20%)
I-set 146..249 CDD:254352 18/102 (18%)
Ig 168..249 CDD:299845 15/80 (19%)
IGc2 268..323 CDD:197706
Ig_3 341..406 CDD:290638
Ig_2 437..514 CDD:290606
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.