Sequence 1: | NP_001723.2 | Gene: | BTN1A1 / 696 | HGNCID: | 1135 | Length: | 526 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001260013.1 | Gene: | ed / 33619 | FlyBaseID: | FBgn0000547 | Length: | 1332 | Species: | Drosophila melanogaster |
Alignment Length: | 277 | Identity: | 55/277 - (19%) |
---|---|---|---|
Similarity: | 89/277 - (32%) | Gaps: | 67/277 - (24%) |
- Green bases have known domain annotations that are detailed below.
Human 2 AVFPSSGLPRCLLTL---ILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLEL 63
Human 64 RWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVS---DDGEY--- 122
Human 123 ---TCFFREDGSYEEALVHLKVAALGSDPHISMQ-----------VQENGEIC---------LEC 164
Human 165 TSVGWYPEPQVQW-RTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLGQE 228
Human 229 KKVE--ISIPASSLPRL 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BTN1A1 | NP_001723.2 | IG_like | 35..141 | CDD:214653 | 23/114 (20%) |
Ig_MOG_like | 43..142 | CDD:143190 | 22/107 (21%) | ||
Ig | 162..223 | CDD:299845 | 12/61 (20%) | ||
SPRY_PRY_BTN1_2 | 302..473 | CDD:293991 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 495..526 | ||||
ed | NP_001260013.1 | Ig | 50..147 | CDD:299845 | 25/124 (20%) |
I-set | 146..249 | CDD:254352 | 18/102 (18%) | ||
Ig | 168..249 | CDD:299845 | 15/80 (19%) | ||
IGc2 | 268..323 | CDD:197706 | |||
Ig_3 | 341..406 | CDD:290638 | |||
Ig_2 | 437..514 | CDD:290606 | |||
I-set | 526..633 | CDD:254352 | |||
Ig | 546..632 | CDD:143165 | |||
IG_like | 654..736 | CDD:214653 | |||
Ig | 656..734 | CDD:143165 | |||
FN3 | 741..848 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |