DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTN1A1 and dpr7

DIOPT Version :9

Sequence 1:NP_001723.2 Gene:BTN1A1 / 696 HGNCID:1135 Length:526 Species:Homo sapiens
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:307 Identity:65/307 - (21%)
Similarity:103/307 - (33%) Gaps:104/307 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    16 LILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAV------ 74
            |.|..|..|:...||.|. |..:.|||.|.|.|.||:....:.   .:.|.||:....:      
  Fly    40 LSLNDLTNLERPFFDDIS-PRNVSAVVDEIAILRCRVKNKGNR---TVSWMRKRDLHILTTNIYT 100

Human    75 --------LVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGS 131
                    ::|..|.|.                       ..|:|...:..|.|.|.|....:..
  Fly   101 YTGDQRFSVIHPPGSED-----------------------WDLKIDYAQPRDSGVYECQVNTEPK 142

Human   132 YEEALVHLKVAA-----------------------LGSDPHISMQVQENGEICLECT------SV 167
            ...|:. |:|.|                       |||   ..:.|:.:..|.|.|:      ||
  Fly   143 INLAIC-LQVIADNDFQDLKTKKRFYDTKSARAKILGS---TEIHVKRDSTIALACSVNIHAPSV 203

Human   168 GWY-PEPQVQWRTSKG------EKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLL 225
            .|| ....|.:.:.:|      ||....:.||      |....||  :||:.  |.:| :.|..:
  Fly   204 IWYHGSSVVDFDSLRGGISLETEKTDVGTTSR------LMLTRAS--LRDSG--NYTC-VPNGAI 257

Human   226 GQEKKVEI-------SIPASSLPRLTPW-----IVAVAVILMVLGLL 260
            ....:|.:       ::..||..|:..:     |::..|:|.:..|:
  Fly   258 PASVRVHVLTGEQPAAMQTSSAIRIRAFTAMITIISTKVLLYISSLM 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTN1A1NP_001723.2 IG_like 35..141 CDD:214653 23/119 (19%)
Ig_MOG_like 43..142 CDD:143190 19/112 (17%)
Ig 162..223 CDD:299845 19/73 (26%)
SPRY_PRY_BTN1_2 302..473 CDD:293991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..526
dpr7NP_001096850.2 V-set 56..145 CDD:284989 22/115 (19%)
IG_like 58..140 CDD:214653 21/107 (20%)
IG_like 179..265 CDD:214653 24/99 (24%)
Ig 187..257 CDD:299845 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.