DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTK and HSE1

DIOPT Version :9

Sequence 1:NP_001274273.1 Gene:BTK / 695 HGNCID:1133 Length:693 Species:Homo sapiens
Sequence 2:NP_011861.1 Gene:HSE1 / 856387 SGDID:S000000994 Length:452 Species:Saccharomyces cerevisiae


Alignment Length:271 Identity:62/271 - (22%)
Similarity:96/271 - (35%) Gaps:71/271 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   215 HRKTKKPLPPTPEEDQILKKPLPPE----------PAAAPVSTSELKKVVALYDYMPMNANDLQL 269
            :.|.||    ..|:::...:.||.:          ||....:.:.:::|.||||......::|..
Yeast   178 YEKQKK----LQEQEKESAEVLPQQQQQHQQQNQAPAHKIPAQTVVRRVRALYDLTTNEPDELSF 238

Human   270 RKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTE-AEDSIEMYE--------WYSKHMTRSQA 325
            ||||...:||:....||:.. ..|..|..|.||||. .|.|.|..|        .:|:..|..|.
Yeast   239 RKGDVITVLEQVYRDWWKGA-LRGNMGIFPLNYVTPIVEPSKEEIEKEKNKEAIVFSQKTTIDQL 302

Human   326 EQLLKQEGKEGGF--IVRD-----------------SSKAGKYTVSVFAKSTGDPQGVIRHYVVC 371
            ...|....|.|..  :::|                 :...|||     ||...|...:  ..|:.
Yeast   303 HNSLNAASKTGNSNEVLQDPHIGDMYGSVTPLRPQVTRMLGKY-----AKEKEDMLSL--RQVLA 360

Human   372 STPQSQYYL----AEKHLFSTIPELINY----HQHNSAGL-ISRLKY------------PVSQQN 415
            :..:|...|    |..|:...:|....|    |.:|:..: ..|..|            |:....
Yeast   361 NAERSYNQLMDRAANAHISPPVPGPALYAGMTHANNTPVMPPQRQSYQSNEYSPYPSNLPIQHPT 425

Human   416 KNAPSTAGLGY 426
            .:|.:|...||
Yeast   426 NSANNTPQYGY 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTKNP_001274273.1 PH 38..167 CDD:278594
PH_Btk 40..200 CDD:269944
SH3_BTK 251..305 CDD:212839 20/53 (38%)
SH2_Tec_Btk 308..413 CDD:198260 28/152 (18%)
PTKc_Btk_Bmx 431..686 CDD:173657
Pkinase_Tyr 436..685 CDD:285015
HSE1NP_011861.1 VHS_HSE1 8..140 CDD:340775
SH3_GRB2_like_C 221..273 CDD:212739 20/52 (38%)
GAT_Hse1 290..374 CDD:410591 16/90 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.