Sequence 1: | NP_001274273.1 | Gene: | BTK / 695 | HGNCID: | 1133 | Length: | 693 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011652.1 | Gene: | LSB1 / 853037 | SGDID: | S000003368 | Length: | 241 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 218 | Identity: | 51/218 - (23%) |
---|---|---|---|
Similarity: | 81/218 - (37%) | Gaps: | 50/218 - (22%) |
- Green bases have known domain annotations that are detailed below.
Human 230 QILKKPLPPE---PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDK 291
Human 292 NGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDS-------SKAGKY 349
Human 350 TVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKY-PVSQ 413
Human 414 --------QNKNAPSTAGLGYGS 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BTK | NP_001274273.1 | PH | 38..167 | CDD:278594 | |
PH_Btk | 40..200 | CDD:269944 | |||
SH3_BTK | 251..305 | CDD:212839 | 20/53 (38%) | ||
SH2_Tec_Btk | 308..413 | CDD:198260 | 20/112 (18%) | ||
PTKc_Btk_Bmx | 431..686 | CDD:173657 | |||
Pkinase_Tyr | 436..685 | CDD:285015 | |||
LSB1 | NP_011652.1 | SH3 | 55..108 | CDD:214620 | 19/53 (36%) |
PRK14971 | <100..>156 | CDD:237874 | 14/70 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000006 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |