DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTK and LSB1

DIOPT Version :9

Sequence 1:NP_001274273.1 Gene:BTK / 695 HGNCID:1133 Length:693 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:51/218 - (23%)
Similarity:81/218 - (37%) Gaps:50/218 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   230 QILKKPLPPE---PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDK 291
            :::...||.:   ...:|.:....:.|.||||:......||.|:.||:..:||:.:..|:|.: .
Yeast    32 ELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGK-S 95

Human   292 NGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDS-------SKAGKY 349
            |.:.|..|:|||..|             .|||.:.:  ..|......:.|.|       ..|.:|
Yeast    96 NNKIGIFPANYVKPA-------------FTRSASPK--SAEAASSSTVSRPSVPPPSYEPAASQY 145

Human   350 TVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKY-PVSQ 413
            .....:.....|.|    |:....||.|     :......|...||:|.      .:.:| |.||
Yeast   146 PSQQVSAPYAPPAG----YMQAPPPQQQ-----QAPLPYPPPFTNYYQQ------PQQQYAPPSQ 195

Human   414 --------QNKNAPSTAGLGYGS 428
                    |..:..|:|...:||
Yeast   196 QAPVEAQPQQSSGASSAFKSFGS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTKNP_001274273.1 PH 38..167 CDD:278594
PH_Btk 40..200 CDD:269944
SH3_BTK 251..305 CDD:212839 20/53 (38%)
SH2_Tec_Btk 308..413 CDD:198260 20/112 (18%)
PTKc_Btk_Bmx 431..686 CDD:173657
Pkinase_Tyr 436..685 CDD:285015
LSB1NP_011652.1 SH3 55..108 CDD:214620 19/53 (36%)
PRK14971 <100..>156 CDD:237874 14/70 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.