DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTK and hse1

DIOPT Version :9

Sequence 1:NP_001274273.1 Gene:BTK / 695 HGNCID:1133 Length:693 Species:Homo sapiens
Sequence 2:NP_595425.1 Gene:hse1 / 2540055 PomBaseID:SPBC1734.08 Length:373 Species:Schizosaccharomyces pombe


Alignment Length:212 Identity:56/212 - (26%)
Similarity:85/212 - (40%) Gaps:36/212 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   208 SLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEP---AAAPVSTSELKKVVALYDYMPMNANDLQL 269
            :|....|..::.|...|...:|:.|:|....:.   |.:|.||  :.:|.||||:......:|..
pombe   174 ALSLSESTAQSNKVENPQSTKDEPLQKTNQRQESNLATSPAST--VSRVRALYDFAATEQGELSF 236

Human   270 RKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTE-AEDSIEMYEWYSKHMTRS------QAEQ 327
            :|||...:||.....||:...||. .|..|.|||.. .|.:||. :..|.||.:.      |.::
pombe   237 KKGDIILVLESVYKDWWKGSCKNA-VGIFPVNYVQRVVEPTIEQ-QRQSAHMEQQVFDALPQIDE 299

Human   328 LLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPEL 392
            ||............|.:..|||                 |.::...|: ...|.||:. |...||
pombe   300 LLDTLSTTSPDAADDDALQGKY-----------------HAMIALRPK-LVRLIEKYA-SQKEEL 345

Human   393 INYHQHNSAGLISRLKY 409
            ::.   |...|::|..|
pombe   346 MDL---NERLLVARRDY 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTKNP_001274273.1 PH 38..167 CDD:278594
PH_Btk 40..200 CDD:269944
SH3_BTK 251..305 CDD:212839 20/53 (38%)
SH2_Tec_Btk 308..413 CDD:198260 24/108 (22%)
PTKc_Btk_Bmx 431..686 CDD:173657
Pkinase_Tyr 436..685 CDD:285015
hse1NP_595425.1 VHS 9..140 CDD:197630
SH3_GRB2_like_C 219..271 CDD:212739 20/52 (38%)
GAT 297..362 CDD:281166 18/85 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.