powered by:
Protein Alignment BTK and skb5
DIOPT Version :9
Sequence 1: | NP_001274273.1 |
Gene: | BTK / 695 |
HGNCID: | 1133 |
Length: | 693 |
Species: | Homo sapiens |
Sequence 2: | NP_588016.1 |
Gene: | skb5 / 2539237 |
PomBaseID: | SPCC24B10.13 |
Length: | 140 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 65 |
Identity: | 24/65 - (36%) |
Similarity: | 35/65 - (53%) |
Gaps: | 4/65 - (6%) |
- Green bases have known domain annotations that are detailed below.
Human 240 PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRA-RDKNGQEGYIPSNYV 303
|:| |.:.|...|||||:.|::.|:|....|....||.||:..|..| .|.:|:.|.:|..:|
pombe 75 PSA---SFNVLADAVALYDFEPLHDNELGFTTGQRLCILSESSDGWLIAYDDASGRSGLVPETFV 136
Human 304 303
pombe 137 136
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000006 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.