DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TCF21 and CG33557

DIOPT Version :9

Sequence 1:NP_003197.2 Gene:TCF21 / 6943 HGNCID:11632 Length:179 Species:Homo sapiens
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:132 Identity:40/132 - (30%)
Similarity:58/132 - (43%) Gaps:34/132 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    26 DSNKEFVTSNE----STEESSNCENGSP--QKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAA 84
            |||.....|..    .:|:|...:..:|  |:.:|  ..||:.|.:|                 .
  Fly    21 DSNSSGSASGSGAAADSEDSQIGQEANPGGQENQG--NHRRRPPRQK-----------------I 66

Human    85 NARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAN---------DKY 140
            |||||.|...::.|:..|:..:|..|.:.||||::.:|||||||.||...|..         .||
  Fly    67 NARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTECQPCLLHKY 131

Human   141 EN 142
            |:
  Fly   132 ES 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TCF21NP_003197.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..87 14/66 (21%)
bHLH_TS_TCF21_capsulin 77..140 CDD:381547 24/71 (34%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149596
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.