DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2bl1 and His2B:CG33868

DIOPT Version :9

Sequence 1:NP_081340.1 Gene:H2bl1 / 69382 MGIID:1916632 Length:123 Species:Mus musculus
Sequence 2:NP_001027385.1 Gene:His2B:CG33868 / 3772265 FlyBaseID:FBgn0053868 Length:123 Species:Drosophila melanogaster


Alignment Length:122 Identity:53/122 - (43%)
Similarity:72/122 - (59%) Gaps:9/122 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 AKPTFKRQCYIKRHLRPLYRKHSRCSSINLGHGNYSLYINRVLKEVVPNRGISSYSVDIMNILIN 66
            ||...|.|..|.:..:...||...         :|::||.:|||:|.|:.||||.::.|||..:|
  Fly    10 AKKAGKAQKNITKTDKKKKRKRKE---------SYAIYIYKVLKQVHPDTGISSKAMSIMNSFVN 65

Mouse    67 DIFERIATEACQQMFLRKRCTLTPGDIQQAVHLLLPKKLATLAVTFGSKAVHRFIHS 123
            |||||||.||.:.....||.|:|..:||.||.||||.:||..||:.|:|||.::..|
  Fly    66 DIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2bl1NP_081340.1 H2B 1..120 CDD:304987 52/117 (44%)
Histone <13..100 CDD:278551 35/86 (41%)
His2B:CG33868NP_001027385.1 H2B 33..121 CDD:197718 45/96 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.