DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TCF12 and net

DIOPT Version :9

Sequence 1:XP_011520261.1 Gene:TCF12 / 6938 HGNCID:11623 Length:718 Species:Homo sapiens
Sequence 2:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster


Alignment Length:425 Identity:99/425 - (23%)
Similarity:156/425 - (36%) Gaps:127/425 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   313 STSSSPYVAASHTPPINGSDSILGTRG--NAAGSSQTGDALGKALASIYSPDHTSSSFPSNPSTP 375
            |.|....:....:|..|..|:     |  :|:..|:.||.|....|...|||.......|..|.|
  Fly    14 SASELSAIIMKDSPNSNDRDA-----GFCSASSESEGGDDLVVEHARSGSPDIRPKGTDSADSKP 73

Human   376 VG-------SPSP-----LTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLK 428
            :.       |..|     ||..:....||  .|||.|. |:...||.|:                
  Fly    74 IALVRNKRKSSEPFKVVGLTTPNSKSMPG--PPSSASM-NATGPLKKRI---------------- 119

Human   429 DVCEQSRMEDRLDRLDDAIHVLRNHAVG---PSTSLPAGHSDIHSLL-GPSHNAPIGSLNSNYGG 489
                      |.....|:..||...|:.   |::.:|:.....|.:: .|:|      :...:.|
  Fly   120 ----------RYTSSADSAVVLTPPAIDSPPPNSCIPSTLRLQHEIMPNPAH------IYVRHPG 168

Human   490 SSLVASSRSASMVGTHREDSVSLNGNHSVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVTTEI 554
            .:.:..|.:|     |.|....|        :.|||       |.|...:.|.:.::.:.:.   
  Fly   169 VTTLHRSLAA-----HPEQLEPL--------ALVTT-------KKQCVDQAGPKIEAFSALL--- 210

Human   555 KTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLN---------PEQKIER 610
                      :.:.||:  .|:..|.:||:...||....|.:  |||||         |.|....
  Fly   211 ----------IGKQPSA--KKTLKERTQKESTSSSFLEASLS--DEDLNKTGLAPISRPHQHQRN 261

Human   611 EK----ERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVR 671
            .|    |||:..|||||.||..|:.|::.|.:....:..::| .:||.:|..|.:.||:|.:...
  Fly   262 YKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQK-LSKLSVLRVACSYILTLSRMAG 325

Human   672 E-----RNLNPKAACL-------------KRREEE 688
            |     :::...|.||             ||:::|
  Fly   326 EDYSADQSVPSIATCLEAVTSTIQTEGKVKRKKDE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TCF12XP_011520261.1 CytochromB561_N 287..>460 CDD:286826 38/163 (23%)
HLH 619..672 CDD:197674 18/52 (35%)
netNP_001259789.1 HLH 269..320 CDD:278439 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.