DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TCF12 and sage

DIOPT Version :9

Sequence 1:XP_011520261.1 Gene:TCF12 / 6938 HGNCID:11623 Length:718 Species:Homo sapiens
Sequence 2:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster


Alignment Length:232 Identity:53/232 - (22%)
Similarity:95/232 - (40%) Gaps:55/232 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   472 LGPSHNAPIGSLNSNY----GGSSLVA------SSRSASMVGTHREDSVS---LNGNHSVLSSTV 523
            ||...::...:::.||    .|:.|:|      .|.|.|::|.:.:::.:   |...:||:...|
  Fly    51 LGAPQSSSCPAVSLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKEAHNMGLLPPTYSVIPQPV 115

Human   524 TTSSTDLNHKTQENYRGGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVS 588
            :.            :..| |..:|:.|..|.     .|...|..||               :.:|
  Fly   116 SM------------WHAG-QVATGSPVGLEC-----NKPSELVPPP---------------MYMS 147

Human   589 SRGRTSSTNEDEDL----NP---EQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKS 646
            ..|.:.:.:.:.|:    ||   |:.::.||:.|.....|||.|:||:|.||..|.....:...:
  Fly   148 YSGGSIANSTEVDIAKEHNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPN 212

Human   647 EKPQTKLLILHQAVAVILSLEQQVRERNL--NPKAAC 681
            .|..:|:..|..|:..|..|:..:||.::  |....|
  Fly   213 GKKYSKIESLRIAINYINHLQAMLRESSVGQNGNGCC 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TCF12XP_011520261.1 CytochromB561_N 287..>460 CDD:286826
HLH 619..672 CDD:197674 16/52 (31%)
sageNP_524287.1 HLH 181..233 CDD:278439 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.