DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TCEA1 and Polr1H

DIOPT Version :10

Sequence 1:NP_006747.1 Gene:TCEA1 / 6917 HGNCID:11612 Length:301 Species:Homo sapiens
Sequence 2:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster


Alignment Length:95 Identity:28/95 - (29%)
Similarity:40/95 - (42%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   206 LRKNVLCGN----IPPDLFARMTAEEMASDELKEMRK--NLTKEAIREHQMAKTGGTQTDLFTCG 264
            ::.||:|.|    ..||:::...:|........:..|  |.||   ||.:....|.....  .|.
  Fly    23 VKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTK---RESESDADGPVVER--KCP 82

Human   265 KCKKKNCTYTQVQTRSADEPMTTFVVCNEC 294
            ||.....:|..:|.|||||..|.|..|.:|
  Fly    83 KCNHDKMSYATLQLRSADEGQTVFFTCLKC 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TCEA1NP_006747.1 TFSII 4..301 CDD:273592 28/95 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..137
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 28/95 (29%)
Zn-ribbon_RPA12 73..119 CDD:259792 15/42 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.