DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBXAS1 and Cyp4d8

DIOPT Version :9

Sequence 1:NP_001159725.2 Gene:TBXAS1 / 6916 HGNCID:11609 Length:579 Species:Homo sapiens
Sequence 2:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster


Alignment Length:532 Identity:131/532 - (24%)
Similarity:210/532 - (39%) Gaps:132/532 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    65 ESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRD 129
            :.:.::..|.||:|...:|....::...|....:|..|....|.:                  ..
  Fly    23 DRRRKVANLPGPICPPLIGAMQLMLRLNPKTFIKVGREYVLKFGH------------------LQ 69

Human   130 KRWEEVRGALMSAFSPEKLNELGLLIMQERIKGH---------MG-------GQQAPQR---IPP 175
            :.|...|..:||  ...:||| .||..||.:..|         :|       |:...||   |.|
  Fly    70 RVWIFNRLLIMS--GDAELNE-QLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITP 131

Human   176 TRLSKPSGIYVNLHYATLPFCMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVA 240
            |           .|::.|. ..|.:..|..::.:..|.:.| :|:.||:.|..|....|::|..|
  Fly   132 T-----------FHFSILE-QFVEVFDQQSNICVQRLAQKA-NGNTFDVYRSICAAALDIIAETA 183

Human   241 FGTPVDSWQAPEDPF---VKHCK-----RFFEFCIPRPILVLLLSFPSI---MVPLARILP---- 290
            .||.:.:......|:   |..|.     ||....: :..|:..|:.|.:   ...|.|.:.    
  Fly   184 MGTKIYAQANESTPYAEAVNECTALLSWRFMSVYL-QVELLFTLTHPHLKWRQTQLIRTMQEFTI 247

Human   291 ---NKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSS 352
               .|.|..|....:||:...    |:....:||...|.::|        |...|          
  Fly   248 KVIEKRRQALEDQQSKLMDTA----DEDVGSKRRMALLDVLL--------MSTVD---------- 290

Human   353 TGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLRE- 416
                            .||||.|||..:...|:..|::..|:.|||..:.|:.:|:.|.|:|.| 
  Fly   291 ----------------GRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEI 339

Human   417 VDVFKEKHMAPEFCSLEE--GLPYLDMVIAETLRMYPPA----------FRFTREAAQDCEVLGQ 469
            |.|.......|  .|:.:  .|.|::.||.|:||||||.          |::|.....|     .
  Fly   340 VQVLGTDRSRP--VSIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGD-----G 397

Human   470 RIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLE 534
            .||||:.:.:.:..:|..||.:|:|:.|.|||.  |...:..||..:||.||||:|:|.:...||
  Fly   398 VIPAGSEIIIGIFGVHRQPETFPNPDEFIPERH--ENGSRVAPFKMIPFSAGPRNCIGQKFAQLE 460

Human   535 VKLTLLHVLHKF 546
            :|:.|..::.::
  Fly   461 MKMMLAKIVREY 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBXAS1NP_001159725.2 p450 47..576 CDD:306555 131/532 (25%)
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 122/489 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.