DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBXAS1 and Cyp317a1

DIOPT Version :9

Sequence 1:NP_001159725.2 Gene:TBXAS1 / 6916 HGNCID:11609 Length:579 Species:Homo sapiens
Sequence 2:NP_001286435.1 Gene:Cyp317a1 / 36667 FlyBaseID:FBgn0033982 Length:518 Species:Drosophila melanogaster


Alignment Length:516 Identity:121/516 - (23%)
Similarity:218/516 - (42%) Gaps:114/516 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    75 GPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVAD----SVLFLRDKRWEEV 135
            ||.||:|...:...:|.:.::|:|:::::|.||.:|   ||.....:|    .:..||.:.|:|:
  Fly    76 GPFCGFYALLQPRALILDRELIRQIMIKDFWNFNDR---GLYCNQKSDPLSGDLYALRGESWKEM 137

Human   136 RGALMSAFSPEKLNELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFCMVPL 200
            |..|..:...::::.|...:.:|       .:|....:..|.:|:|   :..:|           
  Fly   138 RQKLDPSLEGDRMSLLYDCLYEE-------AEQLLLTVNSTLMSQP---HSTVH----------- 181

Human   201 ISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGT--------PVDSW-QAPEDPFV 256
                                   ||:....|....:|...||.        |::.: |..|....
  Fly   182 -----------------------IQKIMRRYVLSSLAKCVFGLNAEQRKTYPLEDFEQMTELALN 223

Human   257 KHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERR 321
            .|...:.       :.::::.||:....|......|..:|   :|.||:.:::..|  :.:.:.:
  Fly   224 SHKHGYL-------MNLMMIRFPNFCRMLRMRRTPKQAEE---YFIKLLTSIVEQR--ETSGKPQ 276

Human   322 RDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLI 386
            :|:||:::|         |:..:.:             :.|::..........:|:...|.:||.
  Fly   277 KDYLQLLID---------VKALEFI-------------THQYEADKELGAHLQNELAAHAVVFLK 319

Human   387 AGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEG---LPYLDMVIAETLR 448
            ||||...||||:..|.||.:|:.|.::..||....|:|   :.....||   |.::..||.||||
  Fly   320 AGYEQTANTLSYVLYELALHPELQVRVREEVKKAIERH---DGHITHEGIKSLSFMGQVINETLR 381

Human   449 MYPPAFRFTREAAQDCEV-------LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEA 506
            |:|......|....|..|       |.:.:    .|.:...|:||||:.:|.||.|.|:|::...
  Fly   382 MHPITPYILRRTLNDYAVPDHPKYILVKEL----FLIIPTHAIHHDPDIYPDPEEFKPDRWSGPR 442

Human   507 RQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPL-QLESKSAL 566
            .......|:..||.|.|||:|::...|:::|.|..:|.::.|..  .|:.|| .||...||
  Fly   443 DSLQEQGTWFGFGVGARSCIGIQFAQLQLRLALALLLSEYEFSL--NTRKPLINLEDGIAL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBXAS1NP_001159725.2 p450 47..576 CDD:306555 121/516 (23%)
Cyp317a1NP_001286435.1 p450 39..466 CDD:299894 109/477 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.