DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBXAS1 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_001159725.2 Gene:TBXAS1 / 6916 HGNCID:11609 Length:579 Species:Homo sapiens
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:588 Identity:157/588 - (26%)
Similarity:264/588 - (44%) Gaps:109/588 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     9 LEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQG-----FWESQM 68
            :.|...::|..|::....|:||.||  ....:.||:...:|...:|::...|..     .|.|..
  Fly     1 MSVGTVLLTALLALVGYLLMKWRST--MRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYY 63

Human    69 ELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSV---LFLRD- 129
            ...:..||..|:|..||..:.:.|..:.||:|::.|:.||:|   |.......|.:   |||.| 
  Fly    64 NKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDR---GFFHNPEDDPLSGQLFLLDG 125

Human   130 KRWEEVRGALMSAFSPEKLNELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLP 194
            ::|..:|..|.|.|:..|:..:.                      ||                  
  Fly   126 QKWRTMRNKLSSTFTSGKMKYMF----------------------PT------------------ 150

Human   195 FCMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHC 259
              :|.:.::..|:...::.:    ....:::.....:||||:.:.|||....|.:.|:..|.:..
  Fly   151 --VVKVANEFTDVFGQNVAK----SPVVEVRELLARFTTDVIGTCAFGIECSSLKDPDAEFREMG 209

Human   260 KRFFEFCIPRPI-LVLLLSFPSIMVPLARILPNK-NRDELNGFFNKLIRNVIALRDQQAAEERRR 322
            :|........|: :..:.|||:    |||.|..| ..:.:..||.:::|..:|.|:|.  ..||.
  Fly   210 RRSLTEQRLGPVGIGFVNSFPN----LARRLHMKMTAEPIERFFMRIVRETVAFREQN--NIRRN 268

Human   323 DFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIA 387
            ||:..::|.::  .|:.|          |.:|...|             ||::||..|||:|..|
  Fly   269 DFMDQLIDLKN--KPLMV----------SQSGESVN-------------LTIEEIAAQAFVFFAA 308

Human   388 GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLE------EGLPYLDMVIAET 446
            |:|..:.|:.||.|.||.|.|.|.::.:|.....||      |:.|      :.|.|||.|::||
  Fly   309 GFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEK------CNGELNYESMKDLVYLDQVVSET 367

Human   447 LRMYPPAFRFTREAAQDCEVLGQR---IPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQ 508
            ||:|.......||..:|.||.|..   |..|..:.:..||:|.|.:.:.:|.||||:.|:.|..:
  Fly   368 LRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVK 432

Human   509 QHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKN-GV 572
            :.....:||||.|||:|:|:|.|.::.::.|..::..|:|..|.:|.:|:....:..|...| |:
  Fly   433 ERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGI 497

Human   573 YIK 575
            |:|
  Fly   498 YLK 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBXAS1NP_001159725.2 p450 47..576 CDD:306555 147/550 (27%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 145/549 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130979
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.