DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBXAS1 and Cyp6a20

DIOPT Version :9

Sequence 1:NP_001159725.2 Gene:TBXAS1 / 6916 HGNCID:11609 Length:579 Species:Homo sapiens
Sequence 2:NP_611002.3 Gene:Cyp6a20 / 36664 FlyBaseID:FBgn0033980 Length:501 Species:Drosophila melanogaster


Alignment Length:589 Identity:155/589 - (26%)
Similarity:257/589 - (43%) Gaps:121/589 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    16 VTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLT------FFRQGFWESQMELR-KL 73
            |.:.|.:.::..:.||....|:..::.|:.|.:|....||.:      .|...|..:..:|| |.
  Fly     3 VMIVLLIGVITFVAWYVHQHFNYWKRRGIPHDEPKIPYGNTSELMKTVHFADIFKRTYNKLRNKT 67

Human    74 YGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVAD-----SVLFLRDKRWE 133
            .||..|:|:..:..:|:::.|..|.||:..|..|.:|   |: |.:..|     :::.:..::|:
  Fly    68 DGPFVGFYMYFKRMVVVTDIDFAKTVLIREFDKFHDR---GV-FHNERDDPLSANLVNIDGQKWK 128

Human   134 EVRGALMSAFSPEKLNELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFCMV 198
            .:|..|...|:..|:.                                              .|.
  Fly   129 TLRQKLTPTFTSGKMK----------------------------------------------TMF 147

Human   199 PLISQACDLLLAHLKRYAES-GDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFV------ 256
            |.|....|.|:......|.: .|:.:|......:|.||:.|.|||....|...|:..||      
  Fly   148 PTILTVGDELIRVFGETASADSDSMEITNVVARFTADVIGSCAFGLDCHSLSDPKAKFVQMGTTA 212

Human   257 ----KHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAA 317
                :|.|         .:.:||...|.:   .|::.......|:..|:..:||:.:..|.:.  
  Fly   213 ITERRHGK---------SMDLLLFGAPEL---AAKLRMKATVQEVEDFYMNIIRDTVDYRVKN-- 263

Human   318 EERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAF 382
            ..:|.||:.|:::.:        ..||        .|.|.|            .||.:||..|||
  Fly   264 NVKRHDFVDMLIEMK--------LKFD--------NGDKEN------------GLTFNEIAAQAF 300

Human   383 IFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVD-VFKEKHMAPEFCSLEEGLPYLDMVIAET 446
            ||.:||:|..:.|:.||.|.||.:.|.|:||..|:: |.|:.:...::.|:.| :.||:.||.||
  Fly   301 IFFLAGFETSSTTMGFALYELACHQDIQDKLRTEINTVLKQHNGKLDYDSMRE-MTYLEKVIDET 364

Human   447 LRMYPPAFRFTREAAQDCEVLGQR--IPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQ 509
            :|..|......|.|.|..:....:  |..|..:.:...|:|||||.:|.||.|.||||..:..||
  Fly   365 MRKRPVVGHLIRVATQHYQHTNPKYNIEKGTGVIVPTLAIHHDPEFYPEPEKFIPERFDEDQVQQ 429

Human   510 HRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACP-ETQVPLQLESKS-ALGPKNGV 572
            ....|:||||.|||:|:|:|.|.::|.:.:..::|.|:|:..| :|.|||:..:.. .|..|.|:
  Fly   430 RPACTFLPFGDGPRNCIGLRFGRMQVIVGMALLIHNFKFEFHPTKTVVPLEYRTDDFLLSSKGGI 494

Human   573 YIKI 576
            ::|:
  Fly   495 HLKV 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBXAS1NP_001159725.2 p450 47..576 CDD:306555 147/556 (26%)
Cyp6a20NP_611002.3 p450 32..496 CDD:278495 148/556 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130979
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm8447
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.