DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBXAS1 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_001159725.2 Gene:TBXAS1 / 6916 HGNCID:11609 Length:579 Species:Homo sapiens
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:581 Identity:153/581 - (26%)
Similarity:262/581 - (45%) Gaps:105/581 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    16 VTVALSVALLA--LLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFR-----QGFWESQMELRKL 73
            |.:|:.|.|:.  ||||  ..|....:.|.:...:|...:|:||..:     ...|.......:.
  Fly     6 VLLAIVVVLVGYLLLKW--RRALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAIWMDYYNKFRG 68

Human    74 YGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSV---LFLRD-KRWEE 134
            .||..|:|..:|..|::.:..:.|.:|::.|:.||:|   |....:..|.:   |||.| ::|:.
  Fly    69 TGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDR---GFYHNTEDDPLSGQLFLLDGQKWKS 130

Human   135 VRGALMSAFSPEKLNELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFCMVP 199
            :|..|...|:..|:..:...:::   .||.                                .:.
  Fly   131 MRSKLSYTFTSGKMKYMFPTVVK---VGHE--------------------------------FIE 160

Human   200 LISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPF-VKHCKRFF 263
            :..||           .|.....:::.....:||||:.:.|||....|.:.||..| |...:..|
  Fly   161 VFGQA-----------MEKSPIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEFRVMGRRAIF 214

Human   264 EFCIPR--PI-LVLLLSFPSIMVPLARILPNK-NRDELNGFFNKLIRNVIALRDQQAAEERRRDF 324
            |   .|  || :..:.||.:    |||.|..| ..:|...||.:::|..:|.|::.  ..||.||
  Fly   215 E---QRHGPIGIAFINSFQN----LARRLHMKITLEEAEHFFLRIVRETVAFREKN--NIRRNDF 270

Human   325 LQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGY 389
            :..::|.::  ||:          ..|.:|...|             ||::|:..|||:|..||:
  Fly   271 MDQLIDLKN--SPL----------TKSESGESVN-------------LTIEEMAAQAFVFFGAGF 310

Human   390 EIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAF 454
            |..:.|:.||.|.||.:.|.|:::.:|......|:.........:.:.|||.||:||||:|....
  Fly   311 ETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLP 375

Human   455 RFTREAAQDCEVLGQR---IPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYL 516
            ...||..:|.||.|..   |..|..:.:..||:|.|.:.:.:|.||||:.|:.|..::.....:|
  Fly   376 VLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWL 440

Human   517 PFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSAL-GPKNGVYIKI 576
            |||.|||:|:|:|.|.::.:..|..::::|:|..|.:|.:|:....|:.| ..:.|:::|:
  Fly   441 PFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKTFLISSETGIFLKV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBXAS1NP_001159725.2 p450 47..576 CDD:306555 142/546 (26%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 142/546 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130979
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm8447
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.