DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBP and Trf4

DIOPT Version :10

Sequence 1:NP_003185.1 Gene:TBP / 6908 HGNCID:11588 Length:339 Species:Homo sapiens
Sequence 2:NP_608699.1 Gene:Trf4 / 33452 FlyBaseID:FBgn0031444 Length:331 Species:Drosophila melanogaster


Alignment Length:261 Identity:54/261 - (20%)
Similarity:96/261 - (36%) Gaps:42/261 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   112 QGTSGQ---APQLFH----------SQTLTTAPLPGTTPLYPSPMTPMTPIT-PATPASE-SSGI 161
            :|||.:   ..:||.          .:.|.|.|:...:.||..... .:||. |...|.| .|.:
  Fly    31 EGTSAKLSSLDKLFEELKISKESSAKEDLVTEPMKTESYLYKDYFN-KSPIDFPWEKAYEKGSSL 94

Human   162 VPQL----QNIVSTV---------------------NLGCKLDLKTIALRARNAEYNPKRFAAVI 201
            .|..    :||...|                     :..|:..:..:.|....:.::|....:|:
  Fly    95 GPDFYIDYENIFDNVANLAEIEEKLELHFRPFTCVMDFNCRFSMYELCLLLAESRFDPSSHPSVV 159

Human   202 MRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKF 266
            ::|..|.....|.:.||:..| |.:.:.:|....|..|::|.|.:....::|....:..|..:.|
  Fly   160 VKITHPSAQVKIHAGGKISST-ALNADSARSGLFKVIRILQDLDYKVDIMNFSKNIVNASFSMPF 223

Human   267 PIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPI 331
            .|.|:.:...|....:......|.:.|......:...:|.:|.|::..:....|..||..|..||
  Fly   224 KIDLDLMSRRHVVEVAQNRSRRPFITYTTENLGVRFAVFPTGFVLVLHSTSHCETREAIANFLPI 288

Human   332 L 332
            |
  Fly   289 L 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPNP_003185.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
polyglutamine repeat 58..95
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..159 10/33 (30%)
PLN00062 162..338 CDD:177693 38/196 (19%)
Repetitive region 165..241 17/100 (17%)
Repetitive region 255..332 15/76 (20%)
Trf4NP_608699.1 TBP_TLF 131..>234 CDD:447593 21/103 (20%)
TBP 213..292 CDD:425630 17/77 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.