DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINA7 and Spn42Dd

DIOPT Version :9

Sequence 1:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:392 Identity:118/392 - (30%)
Similarity:195/392 - (49%) Gaps:40/392 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    42 MSSINADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMV 106
            ::|:....:..:|:..:....::|:..|||||...|.|:..||..||..|:...||....|...|
  Fly    10 VTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAV 74

Human   107 EIQHGFQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQ 171
            ..::|  .|:..|...::...|::.|.:::.........:...|:..:::|..|...:|...|.:
  Fly    75 AARYG--ALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE 137

Human   172 EINSHVEMQTKGKVVGLI------QDLKPNTIMVLVNYIHFKAQWANPFDPSKTEDSSSFLIDKT 230
            .||..|..||.||:.|:|      .|:|    .:|||.|:||.||.:.|||:||. :|:|.:...
  Fly   138 RINQWVLDQTSGKIKGMIDPGSMTSDVK----ALLVNAIYFKGQWESKFDPAKTR-ASTFQVTAN 197

Human   231 TTVQVPMMHQMEQYYHLVDMELNCTVLQMDYSKNALALFV-LPKEGQMESVE--AAMSSKTLKKW 292
            .:|.|.||.||..:......:|:..|:::.|..:.|::.: ||:|     ||  :|:..|.:...
  Fly   198 KSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPRE-----VEGLSALEEKIVGFA 257

Human   293 NRLLQKGWVDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTED-NGLKLSNRPAGFVLP 356
            ..|:.|. |.|.:|||.|....:|..||.|:||:..:::.:|.|||..| :|.|:|         
  Fly   258 RPLVAKE-VYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVS--------- 312

Human   357 TQAAHKAVLHIGEKGTEAAAVPEVELSDQPE-NTFLHPIIQIDRSFMLLILERSTRSILFLGKVV 420
             |.:|||.|.:.|:|.|||....|.::::.. :|||    ..|..|..:|  |...:|.|.|:||
  Fly   313 -QVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFL----MADHPFAFVI--RDANTIYFQGRVV 370

Human   421 NP 422
            :|
  Fly   371 SP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 114/383 (30%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 114/381 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.