DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINA7 and Spn88Eb

DIOPT Version :9

Sequence 1:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:441 Identity:109/441 - (24%)
Similarity:190/441 - (43%) Gaps:75/441 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    27 VTACHSSQPNAT-LYKMSSI---NADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCS 87
            ||.....:|..: |.:.|.|   ..||:..|.::.....|..|:||||.|...||::..|.:...
  Fly    15 VTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQ 79

Human    88 TQTEIVETLGFN--------LTDTPMVEIQHGFQHLICSLNFPKKELELQIGNALFIGKHLKPLA 144
            |:.|:.:.|...        |....:.:.|..|:       :.:..:||...|.:|:.:.:....
  Fly    80 TERELAQALNLGWALNKQQVLVSYTLAQRQDEFR-------WRQSPMELSSANRIFVDRTINVSN 137

Human   145 KFLNDVKTLYETEVFSTDFSN-ISAAKQEINSHVEMQTKGKVVGLI--QDLKPNTIMVLVNYIHF 206
            ||    .||........||.| .....:|||..:..:|..::..::  :::.|:|::||.|..:.
  Fly   138 KF----NTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYM 198

Human   207 KAQWANPFDPSKTEDSS--SFLIDKTTTVQVPMMHQMEQYYHLVDMELNCTVLQMDY-------- 261
            |.||.:.|   |.|:::  .|.|::.....|.|||:...:...:|..|...::::.|        
  Fly   199 KGQWLSQF---KVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKE 260

Human   262 -------SKNALA-LFVLPKEGQ--MESVEAAMSSKTLKKW--NRLLQKGWVDLFVPKFSISATY 314
                   ||:.:: :.:||...:  :..|.:.:::.::|||  ..|.||  ::|.:|||......
  Fly   261 THISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQK--IELSLPKFQFEQRL 323

Human   315 DLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNRPAGFVLPTQAAHKAVLHIGEKGTEAAAVPE 379
            :|...|..||:...::.||.|..||.|        |...|: ..|.|.|.:.:.|.|:.|||...
  Fly   324 ELTPILSLMGVNTMFTRNATFGDLTAD--------PISLVI-DDAQHLAKIKVDEVGSTAAAATI 379

Human   380 V---ELSDQPENTFL---HPIIQIDRSFMLLILERSTRSILFLGKVVNPTE 424
            :   ..|.||:.|..   ||       |:.||.:....:|||.|...:|.:
  Fly   380 LLVSRSSRQPDPTKFNCNHP-------FVFLIYDEKVDTILFAGVYSDPRQ 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 102/411 (25%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 102/412 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.