DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAL2 and sage

DIOPT Version :10

Sequence 1:NP_005412.1 Gene:TAL2 / 6887 HGNCID:11557 Length:108 Species:Homo sapiens
Sequence 2:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster


Alignment Length:59 Identity:28/59 - (47%)
Similarity:38/59 - (64%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    10 RERWRQQNVNSAFAKLRKLIPTHPPD-KKLSKNETLRLAMRYINFLVKVLGEQSLQQTG 67
            |||.|.:::|.||..||..:|...|: ||.||.|:||:|:.|||.|..:|.|.|:.|.|
  Fly   187 RERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLRESSVGQNG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAL2NP_005412.1 bHLH_TS_TAL2 2..62 CDD:381550 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..108
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 23/48 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.