DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAL2 and Hand

DIOPT Version :10

Sequence 1:NP_005412.1 Gene:TAL2 / 6887 HGNCID:11557 Length:108 Species:Homo sapiens
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:51 Identity:29/51 - (56%)
Similarity:39/51 - (76%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     8 NTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVL 58
            |.:||.|.|::|:||:.||:.||..|.|.||||.:||:||:.|||:||.||
  Fly    64 NKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAL2NP_005412.1 bHLH_TS_TAL2 2..62 CDD:381550 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..108
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 27/49 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.