DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAL2 and HLH3B

DIOPT Version :9

Sequence 1:NP_005412.1 Gene:TAL2 / 6887 HGNCID:11557 Length:108 Species:Homo sapiens
Sequence 2:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster


Alignment Length:114 Identity:54/114 - (47%)
Similarity:64/114 - (56%) Gaps:20/114 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     3 RKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTG 67
            ||:|||||||||||||:.|||:||||:|||||||||||||.||.|::||..|..:|..|..|...
  Fly   166 RKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPS 230

Human    68 --VAAQGNILGLFPQGPHLPGLEDRTLL-------ENYQVPSPGPSHHI 107
              :.||..           |...|..:.       ||.:.|...|..||
  Fly   231 HPIRAQME-----------PNNNDNRMANGHAADGENLENPDVPPVRHI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAL2NP_005412.1 bHLH_TS_TAL2 2..62 CDD:381550 42/58 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..108 7/26 (27%)
HLH3BNP_525055.1 HLH 171..222 CDD:197674 37/50 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7474
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41680
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13864
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5855
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.