DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAL2 and ase

DIOPT Version :9

Sequence 1:NP_005412.1 Gene:TAL2 / 6887 HGNCID:11557 Length:108 Species:Homo sapiens
Sequence 2:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster


Alignment Length:81 Identity:33/81 - (40%)
Similarity:42/81 - (51%) Gaps:15/81 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     8 NTRERWRQQNVNSAFAKLRKLIPTHPPD------------KKLSKNETLRLAMRYINFLVKVLGE 60
            |.|||.|.:.||:.||.||:.||....:            |||||.||||:|:.||..|.|:|| 
  Fly   165 NARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLG- 228

Human    61 QSLQQTGVAAQGNILG 76
              .....:.:|||..|
  Fly   229 --FDFPPLNSQGNSSG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAL2NP_005412.1 bHLH_TS_TAL2 2..62 CDD:381550 29/65 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..108
aseNP_476694.1 HLH <172..224 CDD:278439 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.