DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAL2 and ac

DIOPT Version :10

Sequence 1:NP_005412.1 Gene:TAL2 / 6887 HGNCID:11557 Length:108 Species:Homo sapiens
Sequence 2:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster


Alignment Length:72 Identity:28/72 - (38%)
Similarity:38/72 - (52%) Gaps:14/72 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     8 NTRERWRQQNVNSAFAKLRKLIPT--------------HPPDKKLSKNETLRLAMRYINFLVKVL 58
            |.|||.|.:.||:.|::||:.||.              ...:|||||..||::|:.||..|.|||
  Fly    30 NARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVL 94

Human    59 GEQSLQQ 65
            .|...|:
  Fly    95 HENDQQK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAL2NP_005412.1 bHLH_TS_TAL2 2..62 CDD:381550 27/67 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..108
acNP_476824.1 bHLH_TS_dAS-C_like 25..94 CDD:381587 24/63 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.