DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAL1 and Fer3

DIOPT Version :9

Sequence 1:NP_001274276.1 Gene:TAL1 / 6886 HGNCID:11556 Length:331 Species:Homo sapiens
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:246 Identity:65/246 - (26%)
Similarity:93/246 - (37%) Gaps:74/246 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    99 PAPAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTT 163
            |.|...| :...::|......|.:||   .|..|.:.|:...  |...|  ..:......|:   
  Fly     4 PHPIDQP-TYMPDVPFQPLWGQEAPP---PPIVPYQELIAGF--PCTDL--SLWQRSQVTPL--- 57

Human   164 NNRVKRRPSPYEMEITDG-------PHTKVVRRIFT-------NSRERWRQQNVNGAFAELRKLI 214
               |.:|||      |:|       ...|..||:.:       |.|||.|..|:|.||.:||:.:
  Fly    58 ---VPQRPS------TNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKV 113

Human   215 PTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDD 279
            ||...:|:||:.|.||||:.||.|:|:||:     ||                            
  Fly   114 PTFAYEKRLSRIETLRLAITYIGFMAELLS-----GT---------------------------- 145

Human   280 LLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGP 330
                   |::|..|..|...|.:.:.:.|.|......||||.....|.|.|
  Fly   146 -------PSNSHKSRSDVYGSMNGHHQAPPPAIHPHHLHPAAAYQRDFASP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAL1NP_001274276.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..86
HLH 193..243 CDD:197674 25/49 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..331 16/82 (20%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 21/47 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.