DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAL1 and Hand

DIOPT Version :10

Sequence 1:XP_047285001.1 Gene:TAL1 / 6886 HGNCID:11556 Length:390 Species:Homo sapiens
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:108 Identity:39/108 - (36%)
Similarity:64/108 - (59%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   219 MFTTNNR--VKRRPSPYEMEITDGPH--------TKVVRRIFT-NSRERWRQQNVNGAFAELRKL 272
            ::.|:|.  :|...|..:.:|.:..|        |::|::..| |.:||.|.|::|.||:.||:.
  Fly    20 IYNTSNMFDMKHSESQVQQQIYNTSHLGYVPTSNTRIVKKRNTANKKERRRTQSINNAFSYLREK 84

Human   273 IPTHPPDKKLSKNEILRLAMKYINFLAKLLN-DQEEEGTQRAK 314
            ||..|.|.||||.:.|:||:.|||:|..:|: |.:.:|..||:
  Fly    85 IPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLDPKGGFRAE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAL1XP_047285001.1 bHLH_TS_TAL1 244..308 CDD:381549 29/65 (45%)
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 26/54 (48%)

Return to query results.
Submit another query.