DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Svop and CG33233

DIOPT Version :9

Sequence 1:NP_081081.1 Gene:Svop / 68666 MGIID:1915916 Length:548 Species:Mus musculus
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:496 Identity:105/496 - (21%)
Similarity:198/496 - (39%) Gaps:73/496 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    70 VEDAVEAIGFGRFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMM 134
            |:.|:..||:|..|..:.:::...:|....|.|....|.....||:.....:..||.:.:..||:
  Fly     6 VDTALLTIGYGLGQVIIFMVSFFIYMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMV 70

Mouse   135 SSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAP-VYSWILVLRGLVGFGIGGVPQ-SVTLY 197
            :|....|.::|:||||..::::::..|.:.::||..| :|| :.|:|.:||..:..|.. .|...
  Fly    71 ASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYS-LSVIRIIVGTFLSAVASLQVGFL 134

Mouse   198 AEFLPMKARAKCILLIEVFWAIGTVFEVLLAVFVMPS------------LGWRWLLLLSAAPLLL 250
            .||..:|.|...:.:......:..::..|:|:.::|:            ..||:|::....|..|
  Fly   135 GEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWL 199

Mouse   251 FAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQEDRGKMRD-------- 307
            ..|....:||:..:.:.....:||:..||.|...|.....  .:.|:..|::....|        
  Fly   200 ALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWE--DVDITLSEEKSSTNDQEGFWKTV 262

Mouse   308 ------LFT-PH-FRWTTLLLWFIWFSNAFSYYGL-----VLLTTELFQAGDVCSISSRKKAV-- 357
                  ||: || |::...|  |:.|...|:..||     |:...:...:..:|.:.:.....  
  Fly   263 WYEYKLLFSKPHVFKFFICL--FLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFIN 325

Mouse   358 -EA-----------KCSLACEYLSKEDYMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFIIF 410
             ||           ||:.....|....|....:........|||. |    :.||..:||..:|.
  Fly   326 HEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVH-W----MTRKYVIALHILIS 385

Mouse   411 SLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTP-------EVYPTATRALGLGTCSGMA 468
            .:..:.|.| :.:..:.|:.|:....:.|      |..|       :..|...|...|.....:|
  Fly   386 MILGISLNI-MKQPTVVLIFFVLMMVLPG------VLIPLATSVLVDCLPVNLRGKALCMVRSLA 443

Mouse   469 RVGALITPFIAQVMLESSVYLTLAVYSGCCLLAGVASCFLP 509
            |.|.::...:..:.:..:..:|..:::.|..:..|.:.|.|
  Fly   444 RFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLAVFQP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SvopNP_081081.1 2A0119 9..519 CDD:273328 105/496 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 521..548
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 94/445 (21%)
MFS 23..>208 CDD:119392 42/185 (23%)
MFS 354..>482 CDD:304372 25/139 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.