DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TACR2 and TkR86C

DIOPT Version :9

Sequence 1:NP_001048.2 Gene:TACR2 / 6865 HGNCID:11527 Length:398 Species:Homo sapiens
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:343 Identity:123/343 - (35%)
Similarity:199/343 - (58%) Gaps:24/343 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    26 FSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFN 90
            :.:|..|..:||..:..::.||:.||.||:||:..||.||||||||::||::|||.|::.|..||
  Fly    76 YELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFN 140

Human    91 FVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGI 155
            |::..::.|.||..:|...|......:..|::::.||:.|||:|||||.:.|.|....:.::..|
  Fly   141 FIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRIILVLI 205

Human   156 WLVALALASPQCFYSTVTM-----DQGATKCVVAWPEDSGGKTL--LLYHLVVIALIYFLPLAVM 213
            |.::..|::|...||::..     .:..|.|.:.||:.....::  ..|:|:::.|.|.:|:.||
  Fly   206 WALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVM 270

Human   214 FVAYSVIGLTLWRRAVPGHQAHGANL-RHLQAMK---KFVKTMVLVVLTFAICWLPYHLYFILGS 274
            .:.||::|..||     |.::.|.|. |.:::||   |.|:..:.:|..||||||||||:||...
  Fly   271 LICYSLMGRVLW-----GSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFIYAY 330

Human   275 FQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGF-RLAFRCCPWVTPTKEDKLEL 338
            ....:...|::|.:||..:|||||:.|.||:||..:|.|||..| |:...||..:|..:.|    
  Fly   331 HNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLTRHRFD---- 391

Human   339 TPTTSLSTR--VNRCHTK 354
            :|.:.|:.:  .|| ||:
  Fly   392 SPKSRLTNKNSSNR-HTR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TACR2NP_001048.2 7tm_4 42..>168 CDD:304433 50/125 (40%)
7tm_1 50..307 CDD:278431 99/267 (37%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 108/288 (38%)
7tm_1 100..363 CDD:278431 99/267 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147240
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55548
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314830at33208
OrthoFinder 1 1.000 - - FOG0000620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3520
SonicParanoid 1 1.000 - - X257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.