DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBXT and Doc1

DIOPT Version :9

Sequence 1:NP_001353214.1 Gene:TBXT / 6862 HGNCID:11515 Length:436 Species:Homo sapiens
Sequence 2:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster


Alignment Length:381 Identity:135/381 - (35%)
Similarity:182/381 - (47%) Gaps:83/381 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    37 PTERELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHR 101
            ||...:...||.::||.:|.::..|||:||:||||||.::|::|||:..|.|..||:.|...:.|
  Fly    54 PTLPGVEAKLENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCVLLEMVPIGDCR 118

Human   102 WKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNK-LNGGGQIMLNSLHK 165
            :|:...:|||.|..|||:|..:|:|||||..||||....:.|:||||||. |:..|.|:|.|:||
  Fly   119 YKFSGSQWVPAGGAEPQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNNTLDSSGHIVLASMHK 183

Human   166 YEPRIHIVRVG-------GPQRMITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKER 223
            |:||:||:|..       .||:   :..||||:|:|||||||:.||.|||..|||||.|      
  Fly   184 YQPRLHIIRSSELTQLPWAPQQ---AFVFPETEFVAVTAYQNDRITKLKIDNNPFAKGF------ 239

Human   224 SDHKEMMEEPGDSQQPGYSQSGGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRS 288
                   .|.|.|:......|.     |.|||      ..:..|:    |..|||          
  Fly   240 -------RESGQSRCKRKLNSS-----GNSTL------ESEDDGS----SVSSCD---------- 272

Human   289 SPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSL-- 351
                ||.|.|.......|::                     .|:.|..:.|:.|.::...|.|  
  Fly   273 ----SPQAKRQRQDFEQDST---------------------GSVSPAYYGATHPVANPMSPYLRH 312

Human   352 ---WSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPV----SAPSSSGSP 400
               :..|..|..|.|.|||...|:..|.....||.|.|...||    |.|..|.:|
  Fly   313 HLSYGPSGAAGLPPSIAAAYFGGVPPQILPMPPATYAPTVAPVSPVASQPVGSSTP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBXTNP_001353214.1 T-box 44..219 CDD:307177 90/182 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309 5/28 (18%)
Doc1NP_648283.1 TBOX 58..245 CDD:238106 92/202 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.