DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT4 and Syt7

DIOPT Version :9

Sequence 1:NP_065834.1 Gene:SYT4 / 6860 HGNCID:11512 Length:425 Species:Homo sapiens
Sequence 2:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster


Alignment Length:443 Identity:144/443 - (32%)
Similarity:234/443 - (52%) Gaps:72/443 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    17 VVGIFSAFGLVFTVSLF---AWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDK 78
            ::...:..||:.|::||   .::..:.|.|:.....|.:           .|..:|.....|.|.
  Fly     6 LIACLAILGLIITIALFLAGGYLWWRHKRSQLQFIEPNE-----------DEESSSYSLRAAQDI 59

Human    79 NEVKN---KPAVP---------KNSLHLDLE-----KRDLNGNFPKTNLKP------GSPSDLEN 120
            .:..|   ||.||         :|:::..|.     :..|.|....:..||      |:|.|   
  Fly    60 VDSGNPPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGGSGASQTKPQIISSVGNPGD--- 121

Human   121 ATPKLFLEGEKESVSPESLKSSTSLT-----SEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGL 180
                        ..:.:|...|.|:|     |.:..|.:|.:.|||||:|:....::.:.:.:.|
  Fly   122 ------------GTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKEL 174

Human   181 PAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHFTILSF 245
            ||.| .|.|||||:::|:||:|||:::|::.|:||:|.::|||.|.|.|..::|...||..:..:
  Fly   175 PAKD-LSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDY 238

Human   246 DRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGR---GELLISLCYQSTTNTLTVV 307
            |||||||.||||.:||..::.: ||....:.:      |...:   ||||.||||..:.:.||:.
  Fly   239 DRFSRDDSIGEVFLPLCQVDFA-GKQSFWKAL------KPPAKDKCGELLSSLCYHPSNSILTLT 296

Human   308 VLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISV 372
            ::|||:|...|::|.|||||||.|....||:.|:||.:..||.|.||||.|.|::|.|.:.:.|:
  Fly   297 LIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSL 361

Human   373 EFLVLDSERGSRNEVIGQLVLGAAAEGTGG---EHWKEICDYPRRQIAKWHVL 422
            :.:|:|.:...|||:||:::| |...|:|.   :||:::...||:.:.:||.|
  Fly   362 DVMVMDFDNIGRNELIGRILL-AGKNGSGASETKHWQDMISKPRQTVVQWHRL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT4NP_065834.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..93 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..147 4/24 (17%)
C2A_Synaptotagmin-4-11 153..279 CDD:176034 52/125 (42%)
C2B_Synaptotagmin-4 288..423 CDD:176049 59/141 (42%)
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 52/131 (40%)
C2B_Synaptotagmin-7 277..414 CDD:176050 59/138 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.