DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT4 and Syt4

DIOPT Version :9

Sequence 1:NP_065834.1 Gene:SYT4 / 6860 HGNCID:11512 Length:425 Species:Homo sapiens
Sequence 2:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster


Alignment Length:468 Identity:179/468 - (38%)
Similarity:261/468 - (55%) Gaps:70/468 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    14 IPTVVGIFSAFGLVFTVSLFAWICCQ------RKSSKSNKTPPYKFV--------------HVLK 58
            :|.::|:.:|    ..:|..|.||.:      :|.|:.:.:.|::..              |.||
  Fly    16 VPAILGLTAA----AVLSSVACICARQMRLRNKKQSQHDASFPFQPTRRPTAVRSPSGQPPHYLK 76

Human    59 GVDIYPENLNSKKKFGADDKNEVKNKPAVPKN----------SLHLDLEKRDLNGN----FPKTN 109
            .   .|.....|:........:....|....|          :.|.:.:    |||    .....
  Fly    77 K---SPSPTGGKQMGLLSPMQDQSTSPIAQPNVKYSEEGDGPAQHAEQQ----NGNQLTVVDGNG 134

Human   110 LKPGSPSDLENATPKLFLEGEKE-SVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVN 173
            ||....:.|.::..:....|... ::...||.:...||..::..||||::|.|.|..||.|.:|:
  Fly   135 LKHSLHNSLHHSPVETIANGSVTITLDDHSLTNGKELTVTDQYGKLGTIYFKLRYLAERNALMVS 199

Human   174 IKEARGLPAMDEQSMT--------------SDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFT 224
            |...||||.....|.|              :|||:|:.:||:|:|||||||:|.|.:|.:||.||
  Fly   200 IIRCRGLPCKGGSSGTGDIPTGMNGRTQAATDPYVKLQLLPDKQHKVKTRVVRNTRNPVYDEDFT 264

Human   225 FYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIE---LSEGKMLMNREIIKRNVR-KS 285
            |||:....:|.::|||.||||||:||||:||||:.||:.||   :|:..:.:::||..|::: ::
  Fly   265 FYGLNMNDLQNMSLHFVILSFDRYSRDDVIGEVVCPLTSIEIGDISKEALSISKEIQPRSLKIRA 329

Human   286 SGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTP 350
            .||||||||||:|.....||||:||||:||:.||:||:|||||:.|.:..:||:||||||||.|.
  Fly   330 QGRGELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTL 394

Human   351 NAVFNELFVFDIP-CEG----LEDISVEFLVLDSERGSRNEVIGQLVLGAA-AEGTGGEHWKEIC 409
            :.||||.|.|||| .||    ||.:|:|.::||.:|.::|||||:|.||.. :..|...||.|:|
  Fly   395 SPVFNESFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLELGGPNSSSTALNHWNEVC 459

Human   410 DYPRRQIAKWHVL 422
            :.||||||:||.|
  Fly   460 NSPRRQIAEWHKL 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT4NP_065834.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..93 2/29 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..147 4/20 (20%)
C2A_Synaptotagmin-4-11 153..279 CDD:176034 67/142 (47%)
C2B_Synaptotagmin-4 288..423 CDD:176049 81/141 (57%)
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 67/142 (47%)
C2B_Synaptotagmin-4 332..473 CDD:176049 81/141 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5601
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I2845
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D329810at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 1 1.000 - - otm40578
orthoMCL 1 0.900 - - OOG6_106708
Panther 1 1.100 - - O PTHR10024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9815
SonicParanoid 1 1.000 - - X61
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.