DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT4 and Sytbeta

DIOPT Version :9

Sequence 1:NP_065834.1 Gene:SYT4 / 6860 HGNCID:11512 Length:425 Species:Homo sapiens
Sequence 2:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster


Alignment Length:408 Identity:115/408 - (28%)
Similarity:177/408 - (43%) Gaps:72/408 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    71 KKFGADDKNEVKNKPAVPKNSLHLDLEKR----DLNGNFPKTNLKPG-----SPSDLENA----- 121
            :.||.|.::.:.::|..|.:........|    |.....|..:..||     |||....|     
  Fly   210 RTFGPDGRSSLPSEPGFPHHLARSPSPMRTISLDARCGSPAHSADPGDLRTPSPSQSSLASLAGG 274

Human   122 ------------------TPKLFLEGEKESVSPESLKSS----------------TSLTSEEKQE 152
                              :|.|.....:..|.|....:|                ..||:.|...
  Fly   275 SGMGGSSAGKGVAGGRCLSPLLIPPRSQPGVDPAMGPASPLGALQPDLYRMPDGPVYLTAPESSH 339

Human   153 KLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPE-KKHKVKTRVLRKTLD 216
            .:|.|...::|::......|::.||..|..::|... .|||:::.:.|| ...|.:|.:.|...:
  Fly   340 AVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGF-RDPYVRLMLQPEVDSRKRQTHIHRGESN 403

Human   217 PAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSE-----GKMLMNRE 276
            |.||:.|.| .:...|:|...|...:|.:||:|.:||||||.|.:.|::||:     |.:|    
  Fly   404 PYFDQHFKF-PVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSVEIWGDLL---- 463

Human   277 IIKRNVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKK 341
               |..:....|.|||.||.|......||||::|||:|     ..|.:||||:.|....|||.||
  Fly   464 ---RTKKPKEDRPELLCSLNYLPQAERLTVVIMKARNL-----DTLQEPYVKIYLIQNGKRIKKK 520

Human   342 KTHVKKC--TPNAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEH 404
            ||.:.|.  ..|.::||.|.|::....|.:.::|..|:.:  ||....||...||....|||.:|
  Fly   521 KTSITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYVVGA--GSEATEIGCCGLGPQESGTGCQH 583

Human   405 WKEICDYPRRQIAKWHVL 422
            |.::.:..|:..|.||.:
  Fly   584 WHDMINNARKPTAMWHYI 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT4NP_065834.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..93 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..147 4/35 (11%)
C2A_Synaptotagmin-4-11 153..279 CDD:176034 40/131 (31%)
C2B_Synaptotagmin-4 288..423 CDD:176049 52/137 (38%)
SytbetaNP_648734.1 C2 341..463 CDD:301316 39/123 (32%)
C2B_Synaptotagmin 473..601 CDD:175975 51/134 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.