DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT4 and Syt12

DIOPT Version :9

Sequence 1:NP_065834.1 Gene:SYT4 / 6860 HGNCID:11512 Length:425 Species:Homo sapiens
Sequence 2:NP_001259513.1 Gene:Syt12 / 32290 FlyBaseID:FBgn0261085 Length:787 Species:Drosophila melanogaster


Alignment Length:351 Identity:93/351 - (26%)
Similarity:156/351 - (44%) Gaps:84/351 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   112 PGSPS--DLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEK----LGTLFFSLEY-----NF 165
            |||..  :||.|            :|.:|:.|.::|..::..:.    .|.|...|.|     :.
  Fly   446 PGSMDGINLERA------------ISCDSVTSDSTLFLDQLDQPYTQITGYLCVGLNYDQMSISN 498

Human   166 ERKAFVVNIKEARGL--PAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFY-- 226
            |.....|::.||:||  |...|   :.|.::::.::|:....::|:|::.||.|:::|:|.|:  
  Fly   499 EGMELTVSVLEAKGLICPFSVE---SLDTFVRIYLVPDHPGAMQTKVVKGTLTPSYNESFDFWLH 560

Human   227 ---------------GIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPL-SGIELSEGKMLMNR 275
                           |..:|.|.|..:.              |||:..|: :.|.||:.      
  Fly   561 KRQARHSLWFHLYHNGPAHTLIGEAEME--------------IGEMPRPITTWIPLSDS------ 605

Human   276 EIIKRNVRKSSGR-GELLISLCYQSTTNTLTVVVLKARHL--------PKSDVSGLSDPYVKVNL 331
                   ||.:.| |||:.||.|..|...||:||:|||:|        |:| ...:...:|||.|
  Fly   606 -------RKCNARWGELMFSLSYLPTAERLTIVVVKARNLKLDGEQPAPES-AETVHSVFVKVYL 662

Human   332 YHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAA 396
            ....:::.||:|.:|:...:.:|||..:|.:|...|....:...|. ....|....:|.:|.|:.
  Fly   663 MDKDRKVLKKRTSLKRKDRSPIFNESMIFSVPPPSLTTTQLRVTVF-GVTTSGVTPLGHIVAGSC 726

Human   397 AEGTGGEHWKEICDYPRRQIAKWHVL 422
            |.|.|..||.::....|:.:|.||||
  Fly   727 AVGKGLRHWHQMLSSLRKPVAMWHVL 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT4NP_065834.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..93
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..147 4/19 (21%)
C2A_Synaptotagmin-4-11 153..279 CDD:176034 33/154 (21%)
C2B_Synaptotagmin-4 288..423 CDD:176049 48/144 (33%)
Syt12NP_001259513.1 C2 503..602 CDD:278593 26/115 (23%)
C2B_Synaptotagmin-12 612..753 CDD:176051 47/143 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.