DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT1 and Syt7

DIOPT Version :9

Sequence 1:NP_001129277.1 Gene:SYT1 / 6857 HGNCID:11509 Length:422 Species:Homo sapiens
Sequence 2:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster


Alignment Length:325 Identity:141/325 - (43%)
Similarity:206/325 - (63%) Gaps:19/325 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    97 GGKNAINMKD--VKDLGK----TMKDQALKDDDAETGLTDGE-EKEEPKEEEKLGKLQYSLDYDF 154
            ||..|...|.  :..:|.    |.||.|.|    ...:||.. :..:|  .|.:|::.:||:|||
  Fly   101 GGSGASQTKPQIISSVGNPGDGTTKDSANK----SISMTDMYLDSTDP--SENVGQIHFSLEYDF 159

Human   155 QNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFK-VPYS 218
            ||..|::.::|..||||.|:.|||||||:|.||||||.:.|||:.|:||||.:||.|.|: .|..
  Fly   160 QNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQ 224

Human   219 ELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRY 283
            :|..:.|.:.|:|:||||:.|.|||..:|:..|||......|:.|:...|   :|.|::..||.|
  Fly   225 KLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAK---DKCGELLSSLCY 286

Human   284 VPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEV 348
            .|:...||:.:::|:|||..|:.|.||||||:.|....||::|:||.|...||||.:||||||.|
  Fly   287 HPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNV 351

Human   349 PFEQIQKVQVVVTVLDYDKIGKNDAIGKVFV-GYNSTGA-ELRHWSDMLANPRRPIAQWHTLQVE 411
            |:|:|::..:.|.|:|:|.||:|:.||::.: |.|.:|| |.:||.||::.||:.:.|||.|:.|
  Fly   352 PWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE 416

Human   412  411
              Fly   417  416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT1NP_001129277.1 Syt1_N 6..113 CDD:409248 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142 8/29 (28%)
Phospholipid binding. /evidence=ECO:0000305 136..382 114/247 (46%)
C2A_Synaptotagmin-1-5-6-9-10 143..265 CDD:176031 60/122 (49%)
C2B_Synaptotagmin-1 274..409 CDD:176047 63/136 (46%)
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 60/123 (49%)
C2B_Synaptotagmin-7 277..414 CDD:176050 63/136 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.