DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT1 and Syt4

DIOPT Version :9

Sequence 1:NP_001129277.1 Gene:SYT1 / 6857 HGNCID:11509 Length:422 Species:Homo sapiens
Sequence 2:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster


Alignment Length:473 Identity:146/473 - (30%)
Similarity:230/473 - (48%) Gaps:129/473 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    58 PWALIAIAIVAVLL------VLTCCFCICKKCLFKKKNKKKGKE--------------------- 95
            |.|.:...||..:|      ||:...|||.:.: :.:|||:.:.                     
  Fly     7 PDASVMDTIVPAILGLTAAAVLSSVACICARQM-RLRNKKQSQHDASFPFQPTRRPTAVRSPSGQ 70

Human    96 -----------KGGK---------------------------------------NAINMKDVKDL 110
                       .|||                                       |.:.:.|...|
  Fly    71 PPHYLKKSPSPTGGKQMGLLSPMQDQSTSPIAQPNVKYSEEGDGPAQHAEQQNGNQLTVVDGNGL 135

Human   111 GKTMKDQALKDDDAET-------------GLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVG 162
            ..::.: :|.....||             .||:|:|.....:..|||.:.:.|.|..:.|.|:|.
  Fly   136 KHSLHN-SLHHSPVETIANGSVTITLDDHSLTNGKELTVTDQYGKLGTIYFKLRYLAERNALMVS 199

Human   163 IIQAAELPALDMGGTS-----------------DPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQ 210
            ||:...||.  .||:|                 |||||:.|||||:.|.:|:|.|.|.|||::|.
  Fly   200 IIRCRGLPC--KGGSSGTGDIPTGMNGRTQAATDPYVKLQLLPDKQHKVKTRVVRNTRNPVYDED 262

Human   211 FTF-KVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEK- 273
            ||| .:..::|...:|...:..|||:|:.|:|||...|:.:::.|.:::|   ..|..||.|.: 
  Fly   263 FTFYGLNMNDLQNMSLHFVILSFDRYSRDDVIGEVVCPLTSIEIGDISKE---ALSISKEIQPRS 324

Human   274 -------LGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTI 331
                   .|::..||.:.|.||:||||:|:|:||.:|||.||:||||||:|:.||:|:.||||.:
  Fly   325 LKIRAQGRGELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHV 389

Human   332 KKNTLNPYYNESFSFEVPFEQ-----IQKVQVVVTVLDYDKIGKNDAIGKVFV-GYNSTGAELRH 390
            ||.||:|.:||||:|::|..:     ::.|.:.:.:||:|::.||:.||::.: |.||:...|.|
  Fly   390 KKRTLSPVFNESFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLELGGPNSSSTALNH 454

Human   391 WSDMLANPRRPIAQWHTL 408
            |:::..:|||.||:||.|
  Fly   455 WNEVCNSPRRQIAEWHKL 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT1NP_001129277.1 Syt1_N 6..113 CDD:409248 19/131 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142 7/41 (17%)
Phospholipid binding. /evidence=ECO:0000305 136..382 107/277 (39%)
C2A_Synaptotagmin-1-5-6-9-10 143..265 CDD:176031 49/139 (35%)
C2B_Synaptotagmin-1 274..409 CDD:176047 66/141 (47%)
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 53/147 (36%)
C2B_Synaptotagmin-4 332..473 CDD:176049 66/141 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X61
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.