DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT1 and Sytbeta

DIOPT Version :9

Sequence 1:NP_001129277.1 Gene:SYT1 / 6857 HGNCID:11509 Length:422 Species:Homo sapiens
Sequence 2:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster


Alignment Length:279 Identity:103/279 - (36%)
Similarity:163/279 - (58%) Gaps:17/279 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   137 PKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPD-KKKKFETKVHR 200
            |:....:|:|...:.||:....|.|.:|:|..|..::.||..||||::.|.|: ..:|.:|.:||
  Fly   335 PESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHR 399

Human   201 KTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQS 265
            ...||.|::.|.|.|...:|.||.|::.|.|:||:|.:|||||.::.::.:|.....|.|.||..
  Fly   400 GESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSVEIWGDLLR 464

Human   266 AEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTT 330
            .:|.::::...:| ||.|:|.|.:|||||::|:||..     |.:|||||:|:|||||:|||||:
  Fly   465 TKKPKEDRPELLC-SLNYLPQAERLTVVIMKARNLDT-----LQEPYVKIYLIQNGKRIKKKKTS 523

Human   331 IKK--NTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKND---AIGKVFVGYNSTGAELRH 390
            |.|  :..||.:||:|:|.:....:....:.:.|     :|...   .||...:|...:|...:|
  Fly   524 ITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYV-----VGAGSEATEIGCCGLGPQESGTGCQH 583

Human   391 WSDMLANPRRPIAQWHTLQ 409
            |.||:.|.|:|.|.||.::
  Fly   584 WHDMINNARKPTAMWHYIR 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT1NP_001129277.1 Syt1_N 6..113 CDD:409248
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142 1/4 (25%)
Phospholipid binding. /evidence=ECO:0000305 136..382 92/250 (37%)
C2A_Synaptotagmin-1-5-6-9-10 143..265 CDD:176031 46/122 (38%)
C2B_Synaptotagmin-1 274..409 CDD:176047 55/139 (40%)
SytbetaNP_648734.1 C2 341..463 CDD:301316 45/121 (37%)
C2B_Synaptotagmin 473..601 CDD:175975 55/138 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.