DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT1 and Sytalpha

DIOPT Version :9

Sequence 1:NP_001129277.1 Gene:SYT1 / 6857 HGNCID:11509 Length:422 Species:Homo sapiens
Sequence 2:NP_001188832.1 Gene:Sytalpha / 35068 FlyBaseID:FBgn0261089 Length:504 Species:Drosophila melanogaster


Alignment Length:301 Identity:109/301 - (36%)
Similarity:173/301 - (57%) Gaps:12/301 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   120 KDDDAETGLTDGEEKEEPKE------EEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTS 178
            |.|..:..:|......:||.      .|..|.|..||.||.....|.|.:::|..|......||:
  Fly   190 KLDHTKIDMTLYRSHSQPKTINPVSLNEVRGNLHVSLGYDPVGGLLNVRLLEAQNLQPRQFSGTA 254

Human   179 DPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGE 243
            |||.||.||||||..::|::|::||||||:|||.|:|....:..:|:.:.:||||.:|:|..||.
  Fly   255 DPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKRTVEILLYDFDAYSRHVCIGG 319

Human   244 FKVPMNTVDFGHVTEEWRDLQSAEKEEQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKM-DVG 306
            .|:.:..:|.....:.|..|.||..::.: .||||..||.|:|:|.:|.||:::|:||:.: |..
  Fly   320 SKLHLANLDLSEQLKLWTPLSSASAQDMKVDLGDIMVSLAYLPSAERLMVVLIKARNLRIVDDAR 384

Human   307 GLSDPYVKIHLM-QNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGK 370
            ..||||||:.|: ..||::||:||.:::.||||.|||:.:|:|..|.::...:..||:....:|.
  Fly   385 NSSDPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNEALAFDVAKETLKNCVLEFTVVHDGLLGS 449

Human   371 NDAIGKVFVGYNS--TGAELRHWSDMLANPRRPIAQWHTLQ 409
            ::.:|:..:| ||  ...|.:.:.:.:...:...|||..||
  Fly   450 SEILGRTLIG-NSPEVRTEEKIFFEEVFRAKNATAQWVPLQ 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT1NP_001129277.1 Syt1_N 6..113 CDD:409248
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142 5/27 (19%)
Phospholipid binding. /evidence=ECO:0000305 136..382 98/254 (39%)
C2A_Synaptotagmin-1-5-6-9-10 143..265 CDD:176031 49/121 (40%)
C2B_Synaptotagmin-1 274..409 CDD:176047 50/138 (36%)
SytalphaNP_001188832.1 C2A_Synaptotagmin-8 218..341 CDD:176033 49/122 (40%)
C2B_Synaptotagmin 352..488 CDD:175975 49/136 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.