DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT1 and btsz

DIOPT Version :9

Sequence 1:NP_001129277.1 Gene:SYT1 / 6857 HGNCID:11509 Length:422 Species:Homo sapiens
Sequence 2:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster


Alignment Length:315 Identity:92/315 - (29%)
Similarity:153/315 - (48%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   144 GKLQYSLDYDFQNNQLLVGIIQAAELPALD-MGGTSDPYVKVFLLPDKKK--KFETKVHRKTLNP 205
            |::::::.|:::.:.|.|.:::..:|.|:| ....|||||||:|||||.|  |.:|||.:.||||
  Fly  3398 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNP 3462

Human   206 VFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEE 270
            :|:|...|..|.|.|..:||.:.|:..|.|.::|.:||..|.:....|.:...:|..||...:..
  Fly  3463 IFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPF 3527

Human   271 QEKL---GDICFSLRYVP----------------------------------------TAGKLTV 292
            .|..   |||...|:|:|                                        ..|:|.|
  Fly  3528 DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHV 3592

Human   293 VILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFE-VPFEQIQKV 356
            ::.|||:|..:...|..|.:.|.:|:.:..|..|:||.:.|.||:|.:|.:|.:| |..|::.:.
  Fly  3593 LVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSER 3657

Human   357 QVVVTVLDYDKIGKNDAIGKVFVG-------------YNSTGAELRHWSDMLANP 398
            .:.:||.|:|::..|:.:|.:...             .::||.||..|.:||..|
  Fly  3658 ALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRP 3712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT1NP_001129277.1 Syt1_N 6..113 CDD:409248
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142
Phospholipid binding. /evidence=ECO:0000305 136..382 84/297 (28%)
C2A_Synaptotagmin-1-5-6-9-10 143..265 CDD:176031 46/123 (37%)
C2B_Synaptotagmin-1 274..409 CDD:176047 44/182 (24%)
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 45/121 (37%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 44/179 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.