DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SYT1 and Syt12

DIOPT Version :9

Sequence 1:NP_001129277.1 Gene:SYT1 / 6857 HGNCID:11509 Length:422 Species:Homo sapiens
Sequence 2:NP_001259513.1 Gene:Syt12 / 32290 FlyBaseID:FBgn0261085 Length:787 Species:Drosophila melanogaster


Alignment Length:338 Identity:96/338 - (28%)
Similarity:158/338 - (46%) Gaps:48/338 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    93 GKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYD---- 153
            |...|..:.||::..........|..|..|..:...|           :..|.|...|:||    
  Fly   443 GSVPGSMDGINLERAISCDSVTSDSTLFLDQLDQPYT-----------QITGYLCVGLNYDQMSI 496

Human   154 -FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPY 217
             .:..:|.|.:::|..|.......:.|.:|:::|:||.....:|||.:.||.|.:||.|.|.: :
  Fly   497 SNEGMELTVSVLEAKGLICPFSVESLDTFVRIYLVPDHPGAMQTKVVKGTLTPSYNESFDFWL-H 560

Human   218 SELGGKTLVMAVYDFDRFSKHDIIGEFKV-------PMNTVDFGHVTEEWRDLQSAEKEEQEKLG 275
            ......:|...:|  .....|.:|||.::       |:.|         |..|..:.| ...:.|
  Fly   561 KRQARHSLWFHLY--HNGPAHTLIGEAEMEIGEMPRPITT---------WIPLSDSRK-CNARWG 613

Human   276 DICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDP---------YVKIHLMQNGKRLKKKKTTI 331
            ::.|||.|:|||.:||:|:::|:|| |:| |....|         :||::||...:::.||:|::
  Fly   614 ELMFSLSYLPTAERLTIVVVKARNL-KLD-GEQPAPESAETVHSVFVKVYLMDKDRKVLKKRTSL 676

Human   332 KKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLA 396
            |:...:|.:|||..|.||...:...|:.|||......|.. .:|.:..|..:.|..||||..||:
  Fly   677 KRKDRSPIFNESMIFSVPPPSLTTTQLRVTVFGVTTSGVT-PLGHIVAGSCAVGKGLRHWHQMLS 740

Human   397 NPRRPIAQWHTLQ 409
            :.|:|:|.||.|:
  Fly   741 SLRKPVAMWHVLR 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SYT1NP_001129277.1 Syt1_N 6..113 CDD:409248 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142 4/28 (14%)
Phospholipid binding. /evidence=ECO:0000305 136..382 75/266 (28%)
C2A_Synaptotagmin-1-5-6-9-10 143..265 CDD:176031 34/133 (26%)
C2B_Synaptotagmin-1 274..409 CDD:176047 52/143 (36%)
Syt12NP_001259513.1 C2 503..602 CDD:278593 28/110 (25%)
C2B_Synaptotagmin-12 612..753 CDD:176051 52/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.