DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gng13 and Ggamma30A

DIOPT Version :9

Sequence 1:NP_001129390.1 Gene:Gng13 / 685451 RGDID:1593806 Length:67 Species:Rattus norvegicus
Sequence 2:NP_001285776.1 Gene:Ggamma30A / 45234 FlyBaseID:FBgn0267252 Length:238 Species:Drosophila melanogaster


Alignment Length:67 Identity:27/67 - (40%)
Similarity:42/67 - (62%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKAKCT 65
            ::..|...:||::|::|||.:.:|...||:|.|:..:||:....||.:|....|||||.||.||.
  Fly     6 LQNMDRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDKKNNPWAEKGKCV 70

  Rat    66 IL 67
            |:
  Fly    71 IM 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gng13NP_001129390.1 GGL 6..61 CDD:238024 21/54 (39%)
Ggamma30ANP_001285776.1 GGL 11..67 CDD:238024 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10281
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5293
OMA 1 1.010 - - QHG49271
OrthoDB 1 1.010 - - D1597581at2759
OrthoFinder 1 1.000 - - FOG0006416
OrthoInspector 1 1.000 - - oto97249
orthoMCL 1 0.900 - - OOG6_110441
Panther 1 1.100 - - LDO PTHR15936
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4681
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.