DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SUV39H1 and CG4565

DIOPT Version :10

Sequence 1:NP_001269095.1 Gene:SUV39H1 / 6839 HGNCID:11479 Length:423 Species:Homo sapiens
Sequence 2:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster


Alignment Length:273 Identity:80/273 - (29%)
Similarity:115/273 - (42%) Gaps:55/273 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   165 DGPPRAFVYINEYRVGEGITLNQVAVGCECQDCLWAPTGGC-----CPGASLHKFAYNDQGQVRL 224
            ||........:||   ..:.||.    |.|:       |.|     |.....::|..:....:..
  Fly    30 DGSKEFKFLADEY---NSVLLNP----CHCK-------GACENSEVCAHGGQYEFTEDGSELILR 80

Human   225 RAGLPIYECNSRCRCGYD-CPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEI 288
            .:..|:.|||..|:|..: |.||:|..|.|..|.||.:......|:||..||.|..::.||.||:
  Fly    81 NSANPVIECNDMCKCCRNTCSNRLVYSGPRKHLEIFDSPVYGSKGLRTTAKITKGGYICEYAGEL 145

Human   289 ITSEEAERRGQIYDRQG---ATYLFDL-DYVED----VYTVDAAYYGNISHFVNHSCDPNLQVYN 345
            :|..||  |.:::|.:.   ..|:..| :|..|    |..||.:..|||..::||||:||..:..
  Fly   146 LTVPEA--RSRLHDNEKLGLMNYILVLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAA 208

Human   346 VFIDNLDERLPRIAFFATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIE 410
            |   .:|..:|:|..||.|.|.|.|||.|.|                     |..|..||....:
  Fly   209 V---RIDCPIPKIGIFAARDIAAKEELCFHY---------------------GGEGQYKKMTGGK 249

Human   411 -CKCGTESCRKYL 422
             |.||...|..::
  Fly   250 TCLCGASKCTGFM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SUV39H1NP_001269095.1 CD_SUV39H1_like 54..102 CDD:349289
SET_SUV39H1 169..423 CDD:380923 78/269 (29%)
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 80/273 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.