DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SUV39H1 and E(z)

DIOPT Version :10

Sequence 1:NP_001269095.1 Gene:SUV39H1 / 6839 HGNCID:11479 Length:423 Species:Homo sapiens
Sequence 2:NP_001261682.1 Gene:E(z) / 39203 FlyBaseID:FBgn0000629 Length:765 Species:Drosophila melanogaster


Alignment Length:202 Identity:71/202 - (35%)
Similarity:97/202 - (48%) Gaps:51/202 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   191 GCECQDCLWAPTGGC----CPGASLHKFAYNDQGQVRLRAGLPIYECN-SRCR-CGYD------- 242
            ||.|:       ..|    ||       .|           |.:.||: ..|: ||.|       
  Fly   579 GCRCK-------AQCNTKQCP-------CY-----------LAVRECDPDLCQACGADQFKLTKI 618

Human   243 -CPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGA 306
             |.|..||:|:...| :....|..|||:...|..:||.|:.||.||||:.:||:|||::||:...
  Fly   619 TCKNVCVQRGLHKHL-LMAPSDIAGWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKYMC 682

Human   307 TYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPN--LQVYNVFIDNLDERLPRIAFFATRTIRAG 369
            ::||:|:   :.:.|||...||...|.|||.:||  .:|..|..|:      ||..||.|.|:.|
  Fly   683 SFLFNLN---NDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDH------RIGIFAKRAIQPG 738

Human   370 EELTFDY 376
            |||.|||
  Fly   739 EELFFDY 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SUV39H1NP_001269095.1 CD_SUV39H1_like 54..102 CDD:349289
SET_SUV39H1 169..423 CDD:380923 71/202 (35%)
E(z)NP_001261682.1 PRC2_HTH_1 151..291 CDD:436286
SANT 452..492 CDD:238096
preSET_CXC 579..610 CDD:408079 12/55 (22%)
SET_EZH2 628..747 CDD:380995 53/128 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.