DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SUV39H1 and Set1

DIOPT Version :10

Sequence 1:NP_001269095.1 Gene:SUV39H1 / 6839 HGNCID:11479 Length:423 Species:Homo sapiens
Sequence 2:NP_001015221.1 Gene:Set1 / 3354971 FlyBaseID:FBgn0040022 Length:1641 Species:Drosophila melanogaster


Alignment Length:155 Identity:47/155 - (30%)
Similarity:79/155 - (50%) Gaps:33/155 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   267 WGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDR--QGATYLFDLDYVEDVYTVDAAYYGNI 329
            ||:..:|.|..:..|:||||::|....|:.|...|:.  .|::|||.:| :|.:  :||...||:
  Fly  1514 WGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRID-METI--IDATKCGNL 1575

Human   330 SHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEELTFDYNMQVDPVDMESTRMDSNF 394
            :.|:||||:||.....:.|::  |:  :|..::.:.|...||:|:||..   |::.|        
  Fly  1576 ARFINHSCNPNCYAKVITIES--EK--KIVIYSKQPIGINEEITYDYKF---PLEDE-------- 1625

Human   395 GLAGLPGSPKKRVRIECKCGTESCR 419
                         :|.|.||.:.||
  Fly  1626 -------------KIPCLCGAQGCR 1637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SUV39H1NP_001269095.1 CD_SUV39H1_like 54..102 CDD:349289
SET_SUV39H1 169..423 CDD:380923 47/155 (30%)
Set1NP_001015221.1 RRM_Set1 99..191 CDD:409745
U2AF_lg 255..>386 CDD:273727
N-SET 1352..1496 CDD:463344
SET_SETD1 1490..1637 CDD:380946 45/153 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.