DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SUV39H1 and G9a

DIOPT Version :10

Sequence 1:NP_001269095.1 Gene:SUV39H1 / 6839 HGNCID:11479 Length:423 Species:Homo sapiens
Sequence 2:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster


Alignment Length:299 Identity:99/299 - (33%)
Similarity:139/299 - (46%) Gaps:62/299 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   141 RWEQELNAKRSHLGRITVENEVD-LDGPPRAFVYINEYRVGEGIT-----LNQVAVGCECQDCLW 199
            |..:.:...|:.|.....|:|.| |..|.  |.|:.:..:.:...     ::|:.: |.|.|.  
  Fly  1364 REARPIQVVRNELAMSENEDEADSLMWPD--FRYVTQCIIQQNSVQIDRRVSQMRI-CSCLDS-- 1423

Human   200 APTGGC-CPGASLHK-----------FAYNDQGQVRLRAGLPIYECNSRCRCG-YDCPNRVVQKG 251
            ..:..| |.|||...           |.|.|..        .|:|||..|.|. ..|.|||||.|
  Fly  1424 CSSDRCQCNGASSQNWYTAESRLNADFNYEDPA--------VIFECNDVCGCNQLSCKNRVVQNG 1480

Human   252 IRYDLCIFRTDD-GRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDLDYV 315
            .|..|.|...:| .:|||||.|..:.|.:||..|.|||:|:.||:|      |...:|.||||  
  Fly  1481 TRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTAMEADR------RTDDSYYFDLD-- 1537

Human   316 EDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEELTFDYNMQV 380
             :.:.:||.||||::.|.||||:||:....||.::.|.|.|:||||:.|.|.||||:.|||..:.
  Fly  1538 -NGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDYGEKF 1601

Human   381 DPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCR 419
            ..|:..|.                    :.|:|.|.:|:
  Fly  1602 WRVEHRSC--------------------VGCRCLTTTCK 1620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SUV39H1NP_001269095.1 CD_SUV39H1_like 54..102 CDD:349289
SET_SUV39H1 169..423 CDD:380923 91/270 (34%)
G9aNP_001259088.1 PTZ00121 <68..>188 CDD:173412
EHMT_ZBD 786..933 CDD:411018
ANKYR 1063..1322 CDD:440430
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
SET_EHMT 1391..1622 CDD:380941 92/272 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.