DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SUPT4H1 and spt4

DIOPT Version :9

Sequence 1:NP_003159.1 Gene:SUPT4H1 / 6827 HGNCID:11467 Length:117 Species:Homo sapiens
Sequence 2:NP_610802.1 Gene:spt4 / 36387 FlyBaseID:FBgn0028683 Length:116 Species:Drosophila melanogaster


Alignment Length:112 Identity:70/112 - (62%)
Similarity:94/112 - (83%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMS 65
            ||.:.:|||||.|||||:|||||:.||||.|||:||:.:|:||.|::.|||.||::||||||:.:
  Fly     1 MAFDAIPKDLRGLRACLVCSLVKSFDQFETDGCENCEEFLRMKNNKDNVYDHTSNNFDGIIALTT 65

Human    66 PEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRD 112
            |.||||:||||:|.|..|:||:||:|.|||..:|::|:||:.|||||
  Fly    66 PTDSWVAKWQRLSRFTRGIYAISVSGTLPQSTLRDMKNRGIVYKSRD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SUPT4H1NP_003159.1 Interaction with SUPT5H 2..40 25/37 (68%)
Spt4 11..108 CDD:153422 59/96 (61%)
spt4NP_610802.1 Spt4 11..108 CDD:153422 59/96 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153088
Domainoid 1 1.000 118 1.000 Domainoid score I5876
eggNOG 1 0.900 - - E1_COG5204
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68303
Inparanoid 1 1.050 163 1.000 Inparanoid score I4215
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54989
OrthoDB 1 1.010 - - D1617752at2759
OrthoFinder 1 1.000 - - FOG0003713
OrthoInspector 1 1.000 - - oto91274
orthoMCL 1 0.900 - - OOG6_102281
Panther 1 1.100 - - LDO PTHR12882
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1386
SonicParanoid 1 1.000 - - X2573
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.