DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ciao2a and galla-1

DIOPT Version :9

Sequence 1:NP_080911.1 Gene:Ciao2a / 68250 MGIID:1915500 Length:160 Species:Mus musculus
Sequence 2:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster


Alignment Length:122 Identity:76/122 - (62%)
Similarity:95/122 - (77%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    40 VYDLIRTIRDPEKPNTLEELEVVTESCVEVQEINEDDYLVI-IKFTPTVPHCSLATLIGLCLRVK 103
            :|||:|.|||||||.|||:|.||.|..:.|......:..|: |:|.|||||||||||||||:|||
  Fly    97 IYDLLRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLATLIGLCIRVK 161

Mouse   104 LQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD 160
            ::|.||...||:|||.:|.|.|||:||||||||||:||||||||||::||.|:.:.:
  Fly   162 VERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAAMENPNLRDLVENCIKDEE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ciao2aNP_080911.1 FeS_assembly_P <39..156 CDD:412662 75/116 (65%)
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 75/116 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845924
Domainoid 1 1.000 80 1.000 Domainoid score I8625
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12252
Inparanoid 1 1.050 155 1.000 Inparanoid score I4289
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto92764
orthoMCL 1 0.900 - - OOG6_108130
Panther 1 1.100 - - LDO PTHR12377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4800
SonicParanoid 1 1.000 - - X10503
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.